dbPTM

KIC_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KIC_ARATH
UniProt AC	Q9ZPX9
Protein Name	Calcium-binding protein KIC
Gene Name	KIC
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	135
Subcellular Localization
Protein Description	Calcium-binding regulatory protein that interacts with kinesin motor protein KCBP in a calcium-dependent manner. Inhibits KCBP microtubule binding activity and microtubule-stimulated ATPase activity. Involved in the regulation of trichome branching through its interaction with KCBP..
Protein Sequence	MEPTEKSMLLETTSTTKMETKYEDMLPVMAEKMDVEEFVSELCKGFSLLADPERHLITAESLRRNSGILGIEGMSKEDAQGMVREGDLDGDGALNQTEFCVLMVRLSPEMMEDAETWLEKALTQELCNHNLSSMP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of KIC_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KIC_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KIC_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KIC_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CML42_ARATH	CML42	physical	19720824

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KIC_ARATH

Related Literatures of Post-Translational Modification