CML42_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CML42_ARATH
• UniProt AC: Q9SVG9
• Protein Name: Calcium-binding protein CML42
• Gene Name: CML42
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 191
• Protein Description: Probable calcium sensor that binds calcium in vitro. Involved in the regulation of trichome branching..
• Protein Sequence: MESNNNEKKKVARQSSSFRLRSPSLNALRLQRIFDLFDKNGDGFITVEELSQALTRLGLNADLSDLKSTVESYIQPGNTGLNFDDFSSLHKTLDDSFFGGACGGGENEDDPSSAAENESDLAEAFKVFDENGDGFISARELQTVLKKLGLPEGGEMERVEKMIVSVDRNQDGRVDFFEFKNMMRTVVIPSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	KKKVARQSSSFRLRS HHHHHHHCCCHHHCC	23.54	28011693
16	Phosphorylation	KKVARQSSSFRLRSP HHHHHHCCCHHHCCC	25.76	28011693
17	Phosphorylation	KVARQSSSFRLRSPS HHHHHCCCHHHCCCC	21.45	28011693
22	Phosphorylation	SSSFRLRSPSLNALR CCCHHHCCCCHHHHH	24.35	23776212
24	Phosphorylation	SFRLRSPSLNALRLQ CHHHCCCCHHHHHHH	35.19	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CML42_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CML42_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CML42_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KIC_ARATH	AT2G46600	physical	19720824

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.