UniProt ID | JDP2_RAT | |
---|---|---|
UniProt AC | Q78E65 | |
Protein Name | Jun dimerization protein 2 | |
Gene Name | Jdp2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 163 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin (By similarity).. | |
Protein Sequence | MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
143 | Phosphorylation | RPTCIVRTDSVRTPE CCCEEEECCCCCCCC | 23.02 | 22668510 | |
145 | Phosphorylation | TCIVRTDSVRTPESE CEEEECCCCCCCCCC | 16.94 | 22668510 | |
148 | Phosphorylation | VRTDSVRTPESEGNP EECCCCCCCCCCCCH | 29.29 | 22668510 | |
151 | Phosphorylation | DSVRTPESEGNPLLE CCCCCCCCCCCHHHH | 52.59 | 30181290 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
148 | T | Phosphorylation | Kinase | MAPK8 | P49185 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
148 | T | Oxidation |
| - |
148 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JDP2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRGR_HUMAN | PGR | physical | 12101239 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...