JDP2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: JDP2_RAT
• UniProt AC: Q78E65
• Protein Name: Jun dimerization protein 2
• Gene Name: Jdp2
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 163
• Subcellular Localization: Nucleus .
• Protein Description: Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin (By similarity)..
• Protein Sequence: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
143	Phosphorylation	RPTCIVRTDSVRTPE CCCEEEECCCCCCCC	23.02	22668510
145	Phosphorylation	TCIVRTDSVRTPESE CEEEECCCCCCCCCC	16.94	22668510
148	Phosphorylation	VRTDSVRTPESEGNP EECCCCCCCCCCCCH	29.29	22668510
151	Phosphorylation	DSVRTPESEGNPLLE CCCCCCCCCCCHHHH	52.59	30181290

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
148	T	Phosphorylation	Kinase	MAPK8	P49185	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
148	T	Oxidation	Phosphorylation of Thr-148 by MAPK8 in response to different stress conditions such as, UV irradiation, oxidatives stress and anisomycin treatments.	-
148	T	Phosphorylation	Phosphorylation of Thr-148 by MAPK8 in response to different stress conditions such as, UV irradiation, oxidatives stress and anisomycin treatments.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of JDP2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRGR_HUMAN	PGR	physical	12101239

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.