UniProt ID | IYD1_HUMAN | |
---|---|---|
UniProt AC | Q6PHW0 | |
Protein Name | Iodotyrosine deiodinase 1 {ECO:0000303|PubMed:25395621} | |
Gene Name | IYD {ECO:0000303|PubMed:25395621} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 289 | |
Subcellular Localization |
Cell membrane Single-pass membrane protein . Cytoplasmic vesicle membrane . |
|
Protein Description | Catalyzes the oxidative NADPH-dependent deiodination of monoiodotyrosine (L-MIT) or diiodotyrosine (L-DIT). [PubMed: 15289438] | |
Protein Sequence | MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
94 | Phosphorylation | VKRSQEFYELLNKRR HHHHHHHHHHHHCCC | 12.62 | 23403867 | |
269 | Phosphorylation | LLPVGYPSKEATVPD HCCCCCCCCCCCCCH | 34.34 | 23401153 | |
283 | Phosphorylation | DLKRKPLDQIMVTV- HHHCCCHHHHEEEC- | 44.48 | - | |
283 (in isoform 4) | Phosphorylation | - | 44.48 | - | |
284 | Phosphorylation | LKRKPLDQIMVTV-- HHCCCHHHHEEEC-- | 33.10 | - | |
284 (in isoform 4) | Phosphorylation | - | 33.10 | - | |
293 | Phosphorylation | MVTV----------- EEEC----------- | - | ||
293 (in isoform 4) | Phosphorylation | - | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IYD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IYD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IYD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DDRGK_HUMAN | DDRGK1 | physical | 26186194 | |
DDRGK_HUMAN | DDRGK1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...