| UniProt ID | IYD1_HUMAN | |
|---|---|---|
| UniProt AC | Q6PHW0 | |
| Protein Name | Iodotyrosine deiodinase 1 {ECO:0000303|PubMed:25395621} | |
| Gene Name | IYD {ECO:0000303|PubMed:25395621} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 289 | |
| Subcellular Localization |
Cell membrane Single-pass membrane protein . Cytoplasmic vesicle membrane . |
|
| Protein Description | Catalyzes the oxidative NADPH-dependent deiodination of monoiodotyrosine (L-MIT) or diiodotyrosine (L-DIT). [PubMed: 15289438] | |
| Protein Sequence | MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 94 | Phosphorylation | VKRSQEFYELLNKRR HHHHHHHHHHHHCCC | 12.62 | 23403867 | |
| 269 | Phosphorylation | LLPVGYPSKEATVPD HCCCCCCCCCCCCCH | 34.34 | 23401153 | |
| 283 | Phosphorylation | DLKRKPLDQIMVTV- HHHCCCHHHHEEEC- | 44.48 | - | |
| 283 (in isoform 4) | Phosphorylation | - | 44.48 | - | |
| 284 | Phosphorylation | LKRKPLDQIMVTV-- HHCCCHHHHEEEC-- | 33.10 | - | |
| 284 (in isoform 4) | Phosphorylation | - | 33.10 | - | |
| 293 | Phosphorylation | MVTV----------- EEEC----------- | - | ||
| 293 (in isoform 4) | Phosphorylation | - | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IYD1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IYD1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IYD1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DDRGK_HUMAN | DDRGK1 | physical | 26186194 | |
| DDRGK_HUMAN | DDRGK1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
