| UniProt ID | ITBP2_MOUSE | |
|---|---|---|
| UniProt AC | Q9R000 | |
| Protein Name | Integrin beta-1-binding protein 2 | |
| Gene Name | Itgb1bp2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 350 | |
| Subcellular Localization | ||
| Protein Description | May play a role during maturation and/or organization of muscles cells.. | |
| Protein Sequence | MSLLCYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTVGLHCAEKLPEVPPQPEGPATSSLQEQKPLNTIPKSAETLFRERPKSEMPPKLLPLLISQALGVALEQKELDQEPGAGLDNSLIWTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWAKQLPASCRHDWHQTDSVVVLTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVSLMPSRVEISLVKADPGSWAQLEHPDSLAEKARAGVLLEMDEEESEDSDDDLSWTEEEDEEEEEAMGE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 51 | Phosphorylation | RKRTVDFSEFLNIKG CCCCCCHHHHHCCCC | 23.99 | 21659604 | |
| 119 | Phosphorylation | KLLPLLISQALGVAL HHHHHHHHHHHHHHH | 14.90 | - | |
| 192 | Phosphorylation | WSCCGIQTLDFGAFL CCCCCEEEECCHHHH | 26.78 | 28576409 | |
| 213 | Ubiquitination | VGRHDWAKQLPASCR ECCCHHHHHCCHHHC | 48.38 | - | |
| 313 | Ubiquitination | HPDSLAEKARAGVLL CHHHHHHHHHHCEEE | 37.25 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ITBP2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ITBP2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ITBP2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PPP5_HUMAN | PPP5C | physical | 23184943 | |
| SGT1_HUMAN | SUGT1 | physical | 23184943 | |
| CHRD1_MOUSE | Chordc1 | physical | 23184943 | |
| ITBP2_MOUSE | Itgb1bp2 | physical | 23184943 | |
| HS90A_MOUSE | Hsp90aa1 | physical | 23184943 | |
| HS90B_MOUSE | Hsp90ab1 | physical | 18474241 | |
| SGT1_MOUSE | Sugt1 | physical | 18474241 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...