| UniProt ID | IN35_MOUSE | |
|---|---|---|
| UniProt AC | Q9D8C4 | |
| Protein Name | Interferon-induced 35 kDa protein homolog | |
| Gene Name | Ifi35 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 286 | |
| Subcellular Localization | Nucleus. Nuclear following IFN treatment.. | |
| Protein Description | ||
| Protein Sequence | MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKIPFSVPEVPLVFQGQTKQGRQVPKFVVSNLKVCCPLPEGSALVTFEDPKVVDRLLQQKEHRVNLEDCRLRVQVQPLELPVVTNIQVSSQPDNHRVLVSGFPAGLRLSEEELLDKLEIFFGKAKNGGGDVETREMLQGTVMLGFADEEVAQHLCQIGQFRVPLDRQQVLLRVSPYVSGEIQKAEIKFQQAPHSVLVTNIPDVMDAQELHDILEIHFQKPTRGGGEVEALTVVPSGQQGLAIFTSESS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSVTLQTVL ------CCCHHHHHH | 24.65 | 30352176 | |
| 4 | Phosphorylation | ----MSVTLQTVLYS ----CCCHHHHHHHH | 13.07 | 22324799 | |
| 34 | Phosphorylation | QQLKRERTGSPGAKI HHHHHHHCCCCCCCC | 36.94 | 26239621 | |
| 36 | Phosphorylation | LKRERTGSPGAKIPF HHHHHCCCCCCCCCC | 21.39 | 22942356 | |
| 44 | Phosphorylation | PGAKIPFSVPEVPLV CCCCCCCCCCCCCEE | 31.26 | 26745281 | |
| 57 | Ubiquitination | LVFQGQTKQGRQVPK EEEECCCCCCCCCCE | 42.75 | 27667366 | |
| 89 | Ubiquitination | LVTFEDPKVVDRLLQ EEEECCHHHHHHHHH | 68.18 | - | |
| 107 | Glutathionylation | HRVNLEDCRLRVQVQ HCCCHHHCEEEEEEE | 3.01 | 24333276 | |
| 161 | Ubiquitination | KLEIFFGKAKNGGGD HHHHHHCCCCCCCCC | 51.54 | - | |
| 221 | Acetylation | YVSGEIQKAEIKFQQ CCCCCEEEEEEEEEC | 54.36 | 23954790 | |
| 221 | Ubiquitination | YVSGEIQKAEIKFQQ CCCCCEEEEEEEEEC | 54.36 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IN35_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IN35_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IN35_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PKHO1_MOUSE | Plekho1 | physical | 17197158 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
