UniProt ID | IN35_HUMAN | |
---|---|---|
UniProt AC | P80217 | |
Protein Name | Interferon-induced 35 kDa protein | |
Gene Name | IFI35 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 286 | |
Subcellular Localization | Nucleus. Nuclear following IFN treatment. | |
Protein Description | Not yet known.. | |
Protein Sequence | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSAPLDAAL ------CCHHHHHHH | 38.30 | 30108239 | |
36 | Phosphorylation | LRKELGDSPKDKVPF HHHHHCCCCCCCCCC | 31.86 | 21815630 | |
40 | Ubiquitination | LGDSPKDKVPFSVPK HCCCCCCCCCCCCCC | 58.91 | 21906983 | |
40 (in isoform 2) | Ubiquitination | - | 58.91 | 21906983 | |
40 (in isoform 1) | Ubiquitination | - | 58.91 | 21906983 | |
44 | Phosphorylation | PKDKVPFSVPKIPLV CCCCCCCCCCCCCEE | 31.29 | 23403867 | |
64 | Ubiquitination | QQDPEVPKSLVSNLR CCCCCCCHHHHHHCE | 62.69 | 29967540 | |
122 | Phosphorylation | PLELPMVTTIQMSSQ CCCCCCEEEEEECCC | 16.36 | 22210691 | |
123 | Phosphorylation | LELPMVTTIQMSSQL CCCCCEEEEEECCCC | 9.59 | 22210691 | |
133 (in isoform 2) | Phosphorylation | - | 23.35 | - | |
138 | Phosphorylation | SGRRVLVTGFPASLR CCCEEEEECCCCCCC | 29.01 | - | |
143 | Phosphorylation | LVTGFPASLRLSEEE EEECCCCCCCCCHHH | 17.79 | - | |
154 | Ubiquitination | SEEELLDKLEIFFGK CHHHHHHHHHHHHCC | 48.25 | 21906983 | |
154 (in isoform 1) | Ubiquitination | - | 48.25 | 21906983 | |
156 | Ubiquitination | EELLDKLEIFFGKTR HHHHHHHHHHHCCCC | 43.41 | - | |
156 (in isoform 2) | Ubiquitination | - | 43.41 | 21906983 | |
161 (in isoform 1) | Ubiquitination | - | 38.87 | 21906983 | |
161 | Ubiquitination | KLEIFFGKTRNGGGD HHHHHHCCCCCCCCC | 38.87 | 2190698 | |
163 | Ubiquitination | EIFFGKTRNGGGDVD HHHHCCCCCCCCCCC | 43.19 | - | |
163 (in isoform 2) | Ubiquitination | - | 43.19 | 21906983 | |
178 | Phosphorylation | VRELLPGSVMLGFAR HHHHCCCCEEEEECC | 11.47 | - | |
221 | Ubiquitination | YVNGEIQKAEIRSQP CCCCEEEEEEHHCCC | 54.36 | - | |
223 | Ubiquitination | NGEIQKAEIRSQPVP CCEEEEEEHHCCCCC | 46.07 | - | |
223 (in isoform 2) | Ubiquitination | - | 46.07 | - | |
259 | Ubiquitination | EIHFQKPTRGGGEVE EEEEECCCCCCCEEE | 49.32 | 33845483 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IN35_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IN35_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IN35_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NMI_HUMAN | NMI | physical | 10950963 | |
KDM1A_HUMAN | KDM1A | physical | 23455924 | |
RO52_HUMAN | TRIM21 | physical | 26342464 | |
NMI_HUMAN | NMI | physical | 26342464 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...