UniProt ID | IMUP_HUMAN | |
---|---|---|
UniProt AC | Q9GZP8 | |
Protein Name | Immortalization up-regulated protein | |
Gene Name | IMUP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 106 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSSSDSSSSSSDSDTDVKSHAAGSKQHESIPGKAKKPKVKKKEKGKKEKGKKKEAPH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEFDLGAA -------CCCCCCCC | 11.91 | 20068231 | |
12 | Phosphorylation | LGAALEPTSQKPGVG CCCCCCCCCCCCCCC | 34.12 | 22167270 | |
13 | Phosphorylation | GAALEPTSQKPGVGA CCCCCCCCCCCCCCC | 47.09 | 23663014 | |
15 | Acetylation | ALEPTSQKPGVGAGH CCCCCCCCCCCCCCC | 43.43 | 23954790 | |
29 | Phosphorylation | HGGDPKLSPHKVQGR CCCCCCCCCCCCCCC | 30.96 | 22167270 | |
37 | Phosphorylation | PHKVQGRSEAGAGPG CCCCCCCCCCCCCCC | 38.33 | 25849741 | |
37 (in isoform 2) | Phosphorylation | - | 38.33 | - | |
51 | Phosphorylation | GPKQGHHSSSDSSSS CCCCCCCCCCCCCCC | 26.34 | 28176443 | |
52 | Phosphorylation | PKQGHHSSSDSSSSS CCCCCCCCCCCCCCC | 33.53 | 28176443 | |
53 | Phosphorylation | KQGHHSSSDSSSSSS CCCCCCCCCCCCCCC | 44.52 | 28176443 | |
55 | Phosphorylation | GHHSSSDSSSSSSDS CCCCCCCCCCCCCCC | 33.78 | 28176443 | |
56 | Phosphorylation | HHSSSDSSSSSSDSD CCCCCCCCCCCCCCC | 38.95 | 28176443 | |
57 | Phosphorylation | HSSSDSSSSSSDSDT CCCCCCCCCCCCCCC | 37.89 | 28176443 | |
58 | Phosphorylation | SSSDSSSSSSDSDTD CCCCCCCCCCCCCCH | 35.49 | 28176443 | |
59 | Phosphorylation | SSDSSSSSSDSDTDV CCCCCCCCCCCCCHH | 39.86 | 28176443 | |
60 | Phosphorylation | SDSSSSSSDSDTDVK CCCCCCCCCCCCHHH | 42.98 | 28176443 | |
62 | Phosphorylation | SSSSSSDSDTDVKSH CCCCCCCCCCHHHHH | 44.34 | 25849741 | |
64 | Phosphorylation | SSSSDSDTDVKSHAA CCCCCCCCHHHHHHH | 46.79 | 28176443 | |
73 | Phosphorylation | VKSHAAGSKQHESIP HHHHHHHCCCCCCCC | 25.15 | - | |
74 | Ubiquitination | KSHAAGSKQHESIPG HHHHHHCCCCCCCCC | 55.55 | 29967540 | |
78 | Phosphorylation | AGSKQHESIPGKAKK HHCCCCCCCCCCCCC | 31.77 | 28355574 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IMUP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IMUP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IMUP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
XIAP_HUMAN | XIAP | physical | 22886722 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-29, AND MASSSPECTROMETRY. |