IMP1L_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IMP1L_HUMAN
• UniProt AC: Q96LU5
• Protein Name: Mitochondrial inner membrane protease subunit 1
• Gene Name: IMMP1L
• Organism: Homo sapiens (Human).
• Sequence Length: 166
• Subcellular Localization: Mitochondrion inner membrane .
• Protein Description: Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO..
• Protein Sequence: MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
104	Phosphorylation	SPSDFFKSHSYVPMG CHHHHHHCCCCCCCC	16.71	28857561
106	Phosphorylation	SDFFKSHSYVPMGHV HHHHHCCCCCCCCEE	34.61	28857561
107	Phosphorylation	DFFKSHSYVPMGHVW HHHHCCCCCCCCEEE	11.80	28857561

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IMP1L_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IMP1L_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IMP1L_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZER1_HUMAN	ZER1	physical	26186194

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.