| UniProt ID | IL7_HUMAN | |
|---|---|---|
| UniProt AC | P13232 | |
| Protein Name | Interleukin-7 | |
| Gene Name | IL7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 177 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.. | |
| Protein Sequence | MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Phosphorylation | EGKDGKQYESVLMVS CCCCCCEEEEEEEEE | 17.41 | 26853621 | |
| 39 | Phosphorylation | KDGKQYESVLMVSID CCCCEEEEEEEEEHH | 18.67 | 26853621 | |
| 44 | Phosphorylation | YESVLMVSIDQLLDS EEEEEEEEHHHHHHH | 13.39 | 26853621 | |
| 51 | Phosphorylation | SIDQLLDSMKEIGSN EHHHHHHHHHHHCHH | 31.55 | 26853621 | |
| 95 | N-linked_Glycosylation | LRQFLKMNSTGDFDL HHHHHHCCCCCCCCE | 34.53 | UniProtKB CARBOHYD | |
| 116 | N-linked_Glycosylation | EGTTILLNCTGQVKG CCCEEEEECCCCCCC | 20.19 | UniProtKB CARBOHYD | |
| 141 | N-linked_Glycosylation | PTKSLEENKSLKEQK CCCCHHHCCCHHHHH | 29.82 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL7_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...