UniProt ID | IL7_HUMAN | |
---|---|---|
UniProt AC | P13232 | |
Protein Name | Interleukin-7 | |
Gene Name | IL7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 177 | |
Subcellular Localization | Secreted. | |
Protein Description | Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.. | |
Protein Sequence | MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Phosphorylation | EGKDGKQYESVLMVS CCCCCCEEEEEEEEE | 17.41 | 26853621 | |
39 | Phosphorylation | KDGKQYESVLMVSID CCCCEEEEEEEEEHH | 18.67 | 26853621 | |
44 | Phosphorylation | YESVLMVSIDQLLDS EEEEEEEEHHHHHHH | 13.39 | 26853621 | |
51 | Phosphorylation | SIDQLLDSMKEIGSN EHHHHHHHHHHHCHH | 31.55 | 26853621 | |
95 | N-linked_Glycosylation | LRQFLKMNSTGDFDL HHHHHHCCCCCCCCE | 34.53 | UniProtKB CARBOHYD | |
116 | N-linked_Glycosylation | EGTTILLNCTGQVKG CCCEEEEECCCCCCC | 20.19 | UniProtKB CARBOHYD | |
141 | N-linked_Glycosylation | PTKSLEENKSLKEQK CCCCHHHCCCHHHHH | 29.82 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL7_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...