UniProt ID | IL3_HUMAN | |
---|---|---|
UniProt AC | P08700 | |
Protein Name | Interleukin-3 | |
Gene Name | IL3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 152 | |
Subcellular Localization | Secreted. | |
Protein Description | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.. | |
Protein Sequence | MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | N-linked_Glycosylation | PLKTSWVNCSNMIDE CCCCCCCCHHHHHHH | 19.76 | UniProtKB CARBOHYD | |
89 | N-linked_Glycosylation | RAVKSLQNASAIESI HHHHHHHCHHHHHHH | 40.95 | UniProtKB CARBOHYD | |
91 | Phosphorylation | VKSLQNASAIESILK HHHHHCHHHHHHHHH | 37.01 | 24850871 | |
95 | Phosphorylation | QNASAIESILKNLLP HCHHHHHHHHHHHHC | 27.40 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IL3RA_HUMAN | IL3RA | physical | 8649415 | |
IL3RB_HUMAN | CSF2RB | physical | 8649415 | |
IL3RA_HUMAN | IL3RA | physical | 7957082 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...