UniProt ID | IL11_HUMAN | |
---|---|---|
UniProt AC | P20809 | |
Protein Name | Interleukin-11 | |
Gene Name | IL11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 199 | |
Subcellular Localization | Secreted . | |
Protein Description | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. [PubMed: 2145578 Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation] | |
Protein Sequence | MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | DPRAELDSTVLLTRS CCCHHHCHHHHHHHH | 32.80 | - | |
42 | Phosphorylation | PRAELDSTVLLTRSL CCHHHCHHHHHHHHH | 18.16 | - | |
46 | Phosphorylation | LDSTVLLTRSLLADT HCHHHHHHHHHHHHH | 17.66 | - | |
184 | Phosphorylation | ILGGLHLTLDWAVRG HHHCHHHHHHHHHHH | 16.36 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MAGAB_HUMAN | MAGEA11 | physical | 16189514 | |
MAGAB_HUMAN | MAGEA11 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...