| UniProt ID | IL11_HUMAN | |
|---|---|---|
| UniProt AC | P20809 | |
| Protein Name | Interleukin-11 | |
| Gene Name | IL11 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 199 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. [PubMed: 2145578 Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation] | |
| Protein Sequence | MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 41 | Phosphorylation | DPRAELDSTVLLTRS CCCHHHCHHHHHHHH | 32.80 | - | |
| 42 | Phosphorylation | PRAELDSTVLLTRSL CCHHHCHHHHHHHHH | 18.16 | - | |
| 46 | Phosphorylation | LDSTVLLTRSLLADT HCHHHHHHHHHHHHH | 17.66 | - | |
| 184 | Phosphorylation | ILGGLHLTLDWAVRG HHHCHHHHHHHHHHH | 16.36 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL11_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL11_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL11_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MAGAB_HUMAN | MAGEA11 | physical | 16189514 | |
| MAGAB_HUMAN | MAGEA11 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...