| UniProt ID | IFN14_HUMAN | |
|---|---|---|
| UniProt AC | P01570 | |
| Protein Name | Interferon alpha-14 | |
| Gene Name | IFNA14 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 189 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.. | |
| Protein Sequence | MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 45 | Dimethylation | LMLMAQMRRISPFSC HHHHHHHHHCCCCCC | 22.24 | - | |
| 45 | Methylation | LMLMAQMRRISPFSC HHHHHHHHHCCCCCC | 22.24 | 115372619 | |
| 46 | Dimethylation | MLMAQMRRISPFSCL HHHHHHHHCCCCCCC | 28.52 | - | |
| 46 | Methylation | MLMAQMRRISPFSCL HHHHHHHHCCCCCCC | 28.52 | 115372623 | |
| 48 | Phosphorylation | MAQMRRISPFSCLKD HHHHHHCCCCCCCCC | 20.34 | 29514088 | |
| 51 | Phosphorylation | MRRISPFSCLKDRHD HHHCCCCCCCCCCCC | 23.17 | 29514088 | |
| 95 | N-linked_Glycosylation | FNLFSTKNSSAAWDE HHHHHCCCCCCCCCH | 41.09 | 9425112 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFN14_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFN14_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFN14_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STIM1_HUMAN | STIM1 | physical | 26186194 | |
| IFNA6_HUMAN | IFNA6 | physical | 26186194 | |
| IFIT3_HUMAN | IFIT3 | physical | 26186194 | |
| TPA_HUMAN | PLAT | physical | 26186194 | |
| ISG15_HUMAN | ISG15 | physical | 26186194 | |
| IFIT1_HUMAN | IFIT1 | physical | 26186194 | |
| IFIT3_HUMAN | IFIT3 | physical | 28514442 | |
| ISG15_HUMAN | ISG15 | physical | 28514442 | |
| IFIT1_HUMAN | IFIT1 | physical | 28514442 | |
| IFNA6_HUMAN | IFNA6 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Identification of nine interferon-alpha subtypes produced by Sendaivirus-induced human peripheral blood leucocytes."; Nyman T.A., Toeloe H., Parkkinen J., Kalkkinen N.; Biochem. J. 329:295-302(1998). Cited for: PROTEIN SEQUENCE OF 24-53, AND GLYCOSYLATION AT ASN-95. | |
