UniProt ID | IFNA6_HUMAN | |
---|---|---|
UniProt AC | P05013 | |
Protein Name | Interferon alpha-6 | |
Gene Name | IFNA6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 189 | |
Subcellular Localization | Secreted. | |
Protein Description | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.. | |
Protein Sequence | MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | LMALVVLSCKSSCSL HHHHHHHHCCCCCCC | 14.11 | 18491316 | |
31 | Phosphorylation | CDLPQTHSLGHRRTM CCCCCCCCCCHHHHH | 39.16 | - | |
37 | Phosphorylation | HSLGHRRTMMLLAQM CCCCHHHHHHHHHHH | 13.59 | - | |
155 | Phosphorylation | QRITLYLTEKKYSPC HHHHHHHCCCCCCCC | 32.00 | 21964256 | |
176 | Phosphorylation | AEIMRSFSSSRNLQE HHHHHHHHCCHHHHH | 28.75 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFNA6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFNA6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFNA6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IFNA6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...