UniProt ID | IFI6_HUMAN | |
---|---|---|
UniProt AC | P09912 | |
Protein Name | Interferon alpha-inducible protein 6 | |
Gene Name | IFI6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 130 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Ubiquitination | GVEAGKKKCSESSDS HHHHCHHHHCCCCCC | 46.62 | - | |
125 | Phosphorylation | ATHKYLDSEEDEE-- HHHHCCCCHHCCC-- | 40.05 | 24719451 | |
133 | Phosphorylation | EEDEE---------- HHCCC---------- | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFI6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFI6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFI6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...