| UniProt ID | IFI27_HUMAN | |
|---|---|---|
| UniProt AC | P40305 | |
| Protein Name | Interferon alpha-inducible protein 27, mitochondrial | |
| Gene Name | IFI27 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 119 | |
| Subcellular Localization |
Mitochondrion . Membrane Multi-pass membrane protein . |
|
| Protein Description | Promotes cell death. Mediates IFN-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9.. | |
| Protein Sequence | MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MEASALTSSAVTSV -CCCHHHCHHHHHHH | 21.98 | 22817900 | |
| 8 | Phosphorylation | MEASALTSSAVTSVA CCCHHHCHHHHHHHH | 19.70 | 25690035 | |
| 13 | Phosphorylation | LTSSAVTSVAKVVRV HCHHHHHHHHHHHHH | 17.30 | 25690035 | |
| 24 | Phosphorylation | VVRVASGSAVVLPLA HHHHHCCCEEHHCHH | 18.52 | - | |
| 35 | Phosphorylation | LPLARIATVVIGGVV HCHHHHHHHHHCCHH | 16.97 | 28857561 | |
| 49 | Phosphorylation | VAVPMVLSAMGFTAA HHHHHHHHHCCCCHH | 12.56 | 28857561 | |
| 62 | Phosphorylation | AAGIASSSIAAKMMS HHHHHCHHHHHHHHH | 17.47 | 28857561 | |
| 69 | Phosphorylation | SIAAKMMSAAAIANG HHHHHHHHHHHHHCC | 15.97 | 22210691 | |
| 81 | Phosphorylation | ANGGGVASGSLVATL HCCCCCCCCCHHHHH | 26.89 | 22210691 | |
| 90 | Phosphorylation | SLVATLQSLGATGLS CHHHHHHHCCCCCCC | 31.70 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFI27_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFI27_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFI27_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SKP2_HUMAN | SKP2 | physical | 27194766 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-7, AND MASSSPECTROMETRY. | |
