IAH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IAH1_SCHPO
• UniProt AC: O74648
• Protein Name: Isoamyl acetate-hydrolyzing esterase
• Gene Name: iah1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 246
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MSDSQDKNYISFEKTEIGQIVSEAPAEKYVSFQKKYFNRLTIIGDSITQKGFTPGGYCAELMNFYQRRLRVDVWGFSGYTSRHVLRYLPEIPLEIDSTKLLIVFLGTNDCQLTETGYMCPVDEFKNNLLALTRPFPHSKIIIVSPGICTKDICFKREQEPYVIAASETVNTLNKSKANSAGLINLYEITKSYPTPELLFTDGLHFSSLGYSLLFNEIVATISKAWPELLPNNLPLQFPHWSEILFT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDSQDKNY ------CCCCCCCCC	46.07	19547744
77	Phosphorylation	RVDVWGFSGYTSRHV CCCCCCCCCCCHHHH	27.27	19547744

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IAH1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IAH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IAH1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IAH1_SCHPO	iah1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.