| UniProt ID | I22R2_HUMAN | |
|---|---|---|
| UniProt AC | Q969J5 | |
| Protein Name | Interleukin-22 receptor subunit alpha-2 | |
| Gene Name | IL22RA2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 263 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.; Isoform 1 may play a role in establishing and maintaining successful pregnancy.. | |
| Protein Sequence | MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 56 | N-linked_Glycosylation | PGRALTGNSSVYFVQ CCCCCCCCCEEEEEE | 26.35 | UniProtKB CARBOHYD | |
| 142 | Phosphorylation | VRAASAGSYSEWSMT EEEECCCCCCCCCCC | 25.79 | 22210691 | |
| 144 | Phosphorylation | AASAGSYSEWSMTPR EECCCCCCCCCCCCC | 34.00 | 22210691 | |
| 147 | Phosphorylation | AGSYSEWSMTPRFTP CCCCCCCCCCCCCCC | 14.55 | 22210691 | |
| 149 | Phosphorylation | SYSEWSMTPRFTPWW CCCCCCCCCCCCCCC | 13.04 | 22210691 | |
| 232 | Phosphorylation | AVEIEALTPHSSYCV EEEEEECCCCCCEEE | 26.46 | 22210691 | |
| 236 | Phosphorylation | EALTPHSSYCVVAEI EECCCCCCEEEEEEE | 21.37 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of I22R2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of I22R2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of I22R2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TBC31_HUMAN | TBC1D31 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
