UniProt ID | HYPM_HUMAN | |
---|---|---|
UniProt AC | O75409 | |
Protein Name | Huntingtin-interacting protein M | |
Gene Name | HYPM | |
Organism | Homo sapiens (Human). | |
Sequence Length | 117 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | KNCKNSSTNNNQTQD CCCCCCCCCCCCCCC | 41.61 | - | |
17 | Phosphorylation | SSTNNNQTQDPSRNE CCCCCCCCCCCCCCC | 36.74 | - | |
21 | Phosphorylation | NNQTQDPSRNELQVP CCCCCCCCCCCCCCC | 56.90 | - | |
49 | Phosphorylation | VQSQSSSTINTLLTL HHHCCHHHHHHHHHH | 21.86 | 19664995 | |
55 | Phosphorylation | STINTLLTLLDCLAD HHHHHHHHHHHHHHH | 28.52 | - | |
73 | Phosphorylation | ERVGLEASNNGSMRN HHHCCCCCCCCCCCC | 22.81 | - | |
77 | Phosphorylation | LEASNNGSMRNTSQD CCCCCCCCCCCCHHH | 19.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HYPM_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HYPM_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HYPM_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CEP44_HUMAN | CEP44 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...