HUB1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HUB1_SCHPO
• UniProt AC: O94650
• Protein Name: Ubiquitin-like modifier hub1
• Gene Name: hub1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 73
• Subcellular Localization: Nucleus. Cytoplasm.
• Protein Description: Forms a conjugate with snu66 and facilitates its localization to the nucleus. Involved in morphogenesis. Required for efficient splicing of pre-mRNA..
• Protein Sequence: MIEVLCNDRLGKKVRVKCMPDDTVGDFKKLVAAQTGTDPRRIVLKKWHSVFKDNITLADYEIHDGMSLEMYYS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of HUB1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HUB1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HUB1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HUB1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RPAB5_SCHPO	rpb10	genetic	15569151
SNU66_SCHPO	snu66	genetic	15569151
SNU66_SCHPO	snu66	genetic	15620657
SNU66_SCHPO	snu66	physical	15620657
CDC28_SCHPO	cdc28	genetic	15620657
CEF1_SCHPO	cdc5	genetic	15620657
YM02_SCHPO	SPAC212.02	genetic	22681890
YHEH_SCHPO	SPBPB2B2.17c	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.