HSFB1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HSFB1_ARATH
• UniProt AC: Q96320
• Protein Name: Heat stress transcription factor B-1
• Gene Name: HSFB1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 284
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE)..
• Protein Sequence: MTAVTAAQRSVPAPFLSKTYQLVDDHSTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHNNFSSFIRQLNTYGFRKTVPDKWEFANDYFRRGGEDLLTDIRRRKSVIASTAGKCVVVGSPSESNSGGGDDHGSSSTSSPGSSKNPGSVENMVADLSGENEKLKRENNNLSSELAAAKKQRDELVTFLTGHLKVRPEQIDKMIKGGKFKPVESDEESECEGCDGGGGAEEGVGEGLKLFGVWLKGERKKRDRDEKNYVVSGSRMTEIKNVDFHAPLWKSSKVCN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Phosphorylation	RRKSVIASTAGKCVV HHHHHEEECCCCEEE	13.99	19880383
111	Phosphorylation	RKSVIASTAGKCVVV HHHHEEECCCCEEEE	30.33	19880383
213	Phosphorylation	GKFKPVESDEESECE CCCCCCCCCCCCCCC	51.02	23328941
217	Phosphorylation	PVESDEESECEGCDG CCCCCCCCCCCCCCC	45.56	23328941

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HSFB1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HSFB1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HSFB1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HSFB1_ARATH	HSF4	physical	19945192

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.