UniProt ID | HSF2B_HUMAN | |
---|---|---|
UniProt AC | O75031 | |
Protein Name | Heat shock factor 2-binding protein | |
Gene Name | HSF2BP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 334 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | May be involved in modulating HSF2 activation in testis. [PubMed: 9651507 Inhibits BNC1 transcriptional activity during spermatogenesis, probably by sequestering it in the cytoplasm (By similarity] | |
Protein Sequence | MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
56 | Ubiquitination | EVLESFQKLKIVEKN HHHHHHHHHHHHHHH | 50.14 | - | |
87 | Phosphorylation | HFKARLETVQADNIR HHHHHHHHHHHHHHH | 23.62 | 23403867 | |
110 | Acetylation | RQQLNEAKQQLLQQA HHHHHHHHHHHHHHH | 32.19 | 164291 | |
149 | Ubiquitination | KAILGGDKALKFFSI HHHHCCCCCHHEEEE | 59.91 | - | |
155 | Phosphorylation | DKALKFFSITGQTME CCCHHEEEECHHHHH | 23.52 | 26270265 | |
157 | Phosphorylation | ALKFFSITGQTMESF CHHEEEECHHHHHHH | 23.26 | 26270265 | |
160 | Phosphorylation | FFSITGQTMESFVKS EEEECHHHHHHHHHH | 25.01 | 26270265 | |
163 | Phosphorylation | ITGQTMESFVKSLDG ECHHHHHHHHHHCCC | 25.23 | 26270265 | |
236 | Phosphorylation | LKVLMLMSLYNVSIN HHHHHHHHHHCEEEE | 24.60 | 23663014 | |
238 | Phosphorylation | VLMLMSLYNVSINLK HHHHHHHHCEEEECC | 13.25 | 23663014 | |
241 | Phosphorylation | LMSLYNVSINLKGLK HHHHHCEEEECCCCH | 11.34 | 23663014 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSF2B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSF2B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSF2B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSF2B_HUMAN | HSF2BP | physical | 21675959 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...