| UniProt ID | HSF2B_HUMAN | |
|---|---|---|
| UniProt AC | O75031 | |
| Protein Name | Heat shock factor 2-binding protein | |
| Gene Name | HSF2BP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 334 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | May be involved in modulating HSF2 activation in testis. [PubMed: 9651507 Inhibits BNC1 transcriptional activity during spermatogenesis, probably by sequestering it in the cytoplasm (By similarity] | |
| Protein Sequence | MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 56 | Ubiquitination | EVLESFQKLKIVEKN HHHHHHHHHHHHHHH | 50.14 | - | |
| 87 | Phosphorylation | HFKARLETVQADNIR HHHHHHHHHHHHHHH | 23.62 | 23403867 | |
| 110 | Acetylation | RQQLNEAKQQLLQQA HHHHHHHHHHHHHHH | 32.19 | 164291 | |
| 149 | Ubiquitination | KAILGGDKALKFFSI HHHHCCCCCHHEEEE | 59.91 | - | |
| 155 | Phosphorylation | DKALKFFSITGQTME CCCHHEEEECHHHHH | 23.52 | 26270265 | |
| 157 | Phosphorylation | ALKFFSITGQTMESF CHHEEEECHHHHHHH | 23.26 | 26270265 | |
| 160 | Phosphorylation | FFSITGQTMESFVKS EEEECHHHHHHHHHH | 25.01 | 26270265 | |
| 163 | Phosphorylation | ITGQTMESFVKSLDG ECHHHHHHHHHHCCC | 25.23 | 26270265 | |
| 236 | Phosphorylation | LKVLMLMSLYNVSIN HHHHHHHHHHCEEEE | 24.60 | 23663014 | |
| 238 | Phosphorylation | VLMLMSLYNVSINLK HHHHHHHHCEEEECC | 13.25 | 23663014 | |
| 241 | Phosphorylation | LMSLYNVSINLKGLK HHHHHCEEEECCCCH | 11.34 | 23663014 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSF2B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSF2B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSF2B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HSF2B_HUMAN | HSF2BP | physical | 21675959 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
