UniProt ID | HS3S1_HUMAN | |
---|---|---|
UniProt AC | O14792 | |
Protein Name | Heparan sulfate glucosamine 3-O-sulfotransferase 1 | |
Gene Name | HS3ST1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 307 | |
Subcellular Localization | Golgi apparatus lumen . | |
Protein Description | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.. | |
Protein Sequence | MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
33 | Ubiquitination | GQQELLRKAGTLQDD CHHHHHHHHCCCCHH | 51.65 | 21906983 | |
48 | N-linked_Glycosylation | VRDGVAPNGSAQQLP HHCCCCCCCCHHHCC | 47.52 | UniProtKB CARBOHYD | |
120 | Phosphorylation | HQLTVEKTPAYFTSP CCCEEECCCCCCCCC | 10.31 | 22985185 | |
128 | Ubiquitination | PAYFTSPKVPERVYS CCCCCCCCCCHHHHC | 70.91 | - | |
135 | Phosphorylation | KVPERVYSMNPSIRL CCCHHHHCCCCCEEE | 14.82 | - | |
150 | Phosphorylation | LLILRDPSERVLSDY EEEECCHHHHHHHHH | 42.18 | - | |
155 | Phosphorylation | DPSERVLSDYTQVFY CHHHHHHHHHHHHHH | 26.22 | - | |
169 | Ubiquitination | YNHMQKHKPYPSIEE HHHHHHCCCCCCHHH | 53.97 | - | |
189 | Ubiquitination | GRLNVDYKALNRSLY CCCCCCHHHHHHHHH | 41.77 | 21906983 | |
192 | N-linked_Glycosylation | NVDYKALNRSLYHVH CCCHHHHHHHHHHHH | 36.03 | UniProtKB CARBOHYD | |
242 | N-linked_Glycosylation | LKLSPQINASNFYFN HHHCCCCCCCHHEEE | 31.88 | UniProtKB CARBOHYD | |
249 | N-linked_Glycosylation | NASNFYFNKTKGFYC CCCHHEEECCCCEEE | 39.44 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HS3S1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HS3S1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HS3S1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...