| UniProt ID | HPLN1_HUMAN | |
|---|---|---|
| UniProt AC | P10915 | |
| Protein Name | Hyaluronan and proteoglycan link protein 1 | |
| Gene Name | HAPLN1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 354 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
| Protein Description | Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.. | |
| Protein Sequence | MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | N-linked_Glycosylation | WADHLSDNYTLDHDR HHHHCCCCCCCCCCC | 28.45 | UniProtKB CARBOHYD | |
| 56 | N-linked_Glycosylation | VFSHRGGNVTLPCKF EEEECCCCEEEECEE | 26.82 | UniProtKB CARBOHYD | |
| 64 | Phosphorylation | VTLPCKFYRDPTAFG EEEECEEEECCCCCC | 10.29 | - | |
| 72 | Phosphorylation | RDPTAFGSGIHKIRI ECCCCCCCCEEEEEE | 28.28 | 24114839 | |
| 100 | Phosphorylation | DVFVSMGYHKKTYGG CEEEECCCCCCCCCC | 11.21 | - | |
| 105 | Phosphorylation | MGYHKKTYGGYQGRV CCCCCCCCCCEECEE | 19.89 | 22817900 | |
| 108 | Phosphorylation | HKKTYGGYQGRVFLK CCCCCCCEECEEEEC | 11.93 | 17494752 | |
| 118 | Phosphorylation | RVFLKGGSDSDASLV EEEECCCCCCCCEEE | 42.48 | 29396449 | |
| 120 | Phosphorylation | FLKGGSDSDASLVIT EECCCCCCCCEEEEE | 36.45 | 29396449 | |
| 123 | Phosphorylation | GGSDSDASLVITDLT CCCCCCCEEEEECCC | 28.32 | 29396449 | |
| 127 | Phosphorylation | SDASLVITDLTLEDY CCCEEEEECCCHHHH | 19.92 | 29396449 | |
| 130 | Phosphorylation | SLVITDLTLEDYGRY EEEEECCCHHHHCCE | 30.80 | 29396449 | |
| 134 | Phosphorylation | TDLTLEDYGRYKCEV ECCCHHHHCCEEEEE | 8.30 | - | |
| 328 | Phosphorylation | PRRRCSPTEAAVRFV CCCCCCHHHHHHHHC | 23.20 | 24114839 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPLN1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPLN1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPLN1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...