UniProt ID | HPLN1_HUMAN | |
---|---|---|
UniProt AC | P10915 | |
Protein Name | Hyaluronan and proteoglycan link protein 1 | |
Gene Name | HAPLN1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 354 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
Protein Description | Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.. | |
Protein Sequence | MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | N-linked_Glycosylation | WADHLSDNYTLDHDR HHHHCCCCCCCCCCC | 28.45 | UniProtKB CARBOHYD | |
56 | N-linked_Glycosylation | VFSHRGGNVTLPCKF EEEECCCCEEEECEE | 26.82 | UniProtKB CARBOHYD | |
64 | Phosphorylation | VTLPCKFYRDPTAFG EEEECEEEECCCCCC | 10.29 | - | |
72 | Phosphorylation | RDPTAFGSGIHKIRI ECCCCCCCCEEEEEE | 28.28 | 24114839 | |
100 | Phosphorylation | DVFVSMGYHKKTYGG CEEEECCCCCCCCCC | 11.21 | - | |
105 | Phosphorylation | MGYHKKTYGGYQGRV CCCCCCCCCCEECEE | 19.89 | 22817900 | |
108 | Phosphorylation | HKKTYGGYQGRVFLK CCCCCCCEECEEEEC | 11.93 | 17494752 | |
118 | Phosphorylation | RVFLKGGSDSDASLV EEEECCCCCCCCEEE | 42.48 | 29396449 | |
120 | Phosphorylation | FLKGGSDSDASLVIT EECCCCCCCCEEEEE | 36.45 | 29396449 | |
123 | Phosphorylation | GGSDSDASLVITDLT CCCCCCCEEEEECCC | 28.32 | 29396449 | |
127 | Phosphorylation | SDASLVITDLTLEDY CCCEEEEECCCHHHH | 19.92 | 29396449 | |
130 | Phosphorylation | SLVITDLTLEDYGRY EEEEECCCHHHHCCE | 30.80 | 29396449 | |
134 | Phosphorylation | TDLTLEDYGRYKCEV ECCCHHHHCCEEEEE | 8.30 | - | |
328 | Phosphorylation | PRRRCSPTEAAVRFV CCCCCCHHHHHHHHC | 23.20 | 24114839 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPLN1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPLN1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPLN1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...