UniProt ID | HPCL1_MOUSE | |
---|---|---|
UniProt AC | P62748 | |
Protein Name | Hippocalcin-like protein 1 | |
Gene Name | Hpcal1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 193 | |
Subcellular Localization |
Membrane Lipid-anchor . |
|
Protein Description | May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.. | |
Protein Sequence | MGKQNSKLRPEVLQDLREHTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSASQF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGKQNSKLR ------CCCCCCCCC | 40.01 | - | |
7 | Ubiquitination | -MGKQNSKLRPEVLQ -CCCCCCCCCHHHHH | 56.94 | 22790023 | |
38 | S-palmitoylation | YKGFLKDCPTGHLTV HHHHHHCCCCCCCCH | 2.88 | 28680068 | |
50 | Ubiquitination | LTVDEFKKIYANFFP CCHHHHHHHHHHCCC | 46.39 | 22790023 | |
63 | Ubiquitination | FPYGDASKFAEHVFR CCCCCHHHHHHHHHH | 50.76 | 22790023 | |
137 | Ubiquitination | KMVSSVMKMPEDEST HHHHHHHCCCCCCCC | 49.50 | 22790023 | |
147 | Ubiquitination | EDESTPEKRTDKIFR CCCCCCCHHHHHHHH | 62.90 | 27667366 | |
171 | Ubiquitination | LSLEEFIKGAKSDPS CCHHHHHHHCCCCHH | 59.13 | 22790023 | |
174 | Ubiquitination | EEFIKGAKSDPSIVR HHHHHHCCCCHHHHH | 65.15 | 22790023 | |
175 | Phosphorylation | EFIKGAKSDPSIVRL HHHHHCCCCHHHHHH | 54.97 | 30635358 | |
178 | Phosphorylation | KGAKSDPSIVRLLQC HHCCCCHHHHHHEEC | 38.41 | 22324799 | |
185 | S-nitrosylation | SIVRLLQCDPSSASQ HHHHHEECCCCCCCC | 9.30 | 24895380 | |
191 | Phosphorylation | QCDPSSASQF----- ECCCCCCCCC----- | 33.78 | 29899451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPCL1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPCL1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPCL1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CYB5_MOUSE | Cyb5a | physical | 14739275 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...