UniProt ID | CYB5_MOUSE | |
---|---|---|
UniProt AC | P56395 | |
Protein Name | Cytochrome b5 | |
Gene Name | Cyb5a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 134 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein Cytoplasmic side. Microsome membrane Single-pass membrane protein Cytoplasmic side. |
|
Protein Description | Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. It is also involved in several steps of the sterol biosynthesis pathway, particularly in the C-5 double bond introduction during the C-5 desaturation.. | |
Protein Sequence | MAGQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSDTLITTVESNSSWWTNWVIPAISALAVALMYRLYMAED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGQSDKDV ------CCCCCHHHC | 25.40 | - | |
5 | Phosphorylation | ---MAGQSDKDVKYY ---CCCCCHHHCCEE | 45.79 | 30352176 | |
7 | Acetylation | -MAGQSDKDVKYYTL -CCCCCHHHCCEEEH | 70.44 | 23576753 | |
7 | Ubiquitination | -MAGQSDKDVKYYTL -CCCCCHHHCCEEEH | 70.44 | - | |
7 | Malonylation | -MAGQSDKDVKYYTL -CCCCCHHHCCEEEH | 70.44 | 26073543 | |
10 | Malonylation | GQSDKDVKYYTLEEI CCCHHHCCEEEHHHH | 42.55 | 26320211 | |
10 | Ubiquitination | GQSDKDVKYYTLEEI CCCHHHCCEEEHHHH | 42.55 | - | |
10 | Acetylation | GQSDKDVKYYTLEEI CCCHHHCCEEEHHHH | 42.55 | 23576753 | |
11 | Phosphorylation | QSDKDVKYYTLEEIQ CCHHHCCEEEHHHHH | 11.09 | 22817900 | |
13 | Phosphorylation | DKDVKYYTLEEIQKH HHHCCEEEHHHHHHC | 25.30 | 29176673 | |
19 | Acetylation | YTLEEIQKHKDSKST EEHHHHHHCCCCCCE | 59.28 | 23806337 | |
19 | Ubiquitination | YTLEEIQKHKDSKST EEHHHHHHCCCCCCE | 59.28 | - | |
19 | Malonylation | YTLEEIQKHKDSKST EEHHHHHHCCCCCCE | 59.28 | 26320211 | |
24 | Ubiquitination | IQKHKDSKSTWVILH HHHCCCCCCEEEEEE | 63.14 | - | |
24 | Malonylation | IQKHKDSKSTWVILH HHHCCCCCCEEEEEE | 63.14 | 26073543 | |
33 | Acetylation | TWVILHHKVYDLTKF EEEEEEHHHHHHHHH | 31.57 | 21728379 | |
33 | Malonylation | TWVILHHKVYDLTKF EEEEEEHHHHHHHHH | 31.57 | 26073543 | |
39 | Malonylation | HKVYDLTKFLEEHPG HHHHHHHHHHHHCCC | 56.07 | 26073543 | |
39 | Ubiquitination | HKVYDLTKFLEEHPG HHHHHHHHHHHHCCC | 56.07 | - | |
39 | Acetylation | HKVYDLTKFLEEHPG HHHHHHHHHHHHCCC | 56.07 | 23864654 | |
60 | Phosphorylation | EQAGGDATENFEDVG HHHCCCCCCCHHHCC | 35.88 | 26525534 | |
69 | Phosphorylation | NFEDVGHSTDARELS CHHHCCCCCCHHHHH | 23.27 | 23684622 | |
70 | Phosphorylation | FEDVGHSTDARELSK HHHCCCCCCHHHHHC | 28.18 | 26525534 | |
77 | Malonylation | TDARELSKTYIIGEL CCHHHHHCEEEEEEE | 58.95 | 26320211 | |
77 | Ubiquitination | TDARELSKTYIIGEL CCHHHHHCEEEEEEE | 58.95 | - | |
77 | Acetylation | TDARELSKTYIIGEL CCHHHHHCEEEEEEE | 58.95 | 23864654 | |
90 | Phosphorylation | ELHPDDRSKIAKPSD EECCCCHHHCCCCCC | 35.09 | 29514104 | |
96 | Phosphorylation | RSKIAKPSDTLITTV HHHCCCCCCCEEEEE | 42.39 | 29895711 | |
111 | Phosphorylation | ESNSSWWTNWVIPAI CCCCCHHHCCHHHHH | 16.97 | 29895711 | |
127 | Phosphorylation | ALAVALMYRLYMAED HHHHHHHHHHHHCCC | 9.79 | 29895711 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYB5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYB5_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYB5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CYB5_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Substrate and functional diversity of lysine acetylation revealed bya proteomics survey."; Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.; Mol. Cell 23:607-618(2006). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-19, AND MASS SPECTROMETRY. |