| UniProt ID | CYB5_MOUSE | |
|---|---|---|
| UniProt AC | P56395 | |
| Protein Name | Cytochrome b5 | |
| Gene Name | Cyb5a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 134 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein Cytoplasmic side. Microsome membrane Single-pass membrane protein Cytoplasmic side. |
|
| Protein Description | Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. It is also involved in several steps of the sterol biosynthesis pathway, particularly in the C-5 double bond introduction during the C-5 desaturation.. | |
| Protein Sequence | MAGQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSDTLITTVESNSSWWTNWVIPAISALAVALMYRLYMAED | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAGQSDKDV ------CCCCCHHHC | 25.40 | - | |
| 5 | Phosphorylation | ---MAGQSDKDVKYY ---CCCCCHHHCCEE | 45.79 | 30352176 | |
| 7 | Acetylation | -MAGQSDKDVKYYTL -CCCCCHHHCCEEEH | 70.44 | 23576753 | |
| 7 | Ubiquitination | -MAGQSDKDVKYYTL -CCCCCHHHCCEEEH | 70.44 | - | |
| 7 | Malonylation | -MAGQSDKDVKYYTL -CCCCCHHHCCEEEH | 70.44 | 26073543 | |
| 10 | Malonylation | GQSDKDVKYYTLEEI CCCHHHCCEEEHHHH | 42.55 | 26320211 | |
| 10 | Ubiquitination | GQSDKDVKYYTLEEI CCCHHHCCEEEHHHH | 42.55 | - | |
| 10 | Acetylation | GQSDKDVKYYTLEEI CCCHHHCCEEEHHHH | 42.55 | 23576753 | |
| 11 | Phosphorylation | QSDKDVKYYTLEEIQ CCHHHCCEEEHHHHH | 11.09 | 22817900 | |
| 13 | Phosphorylation | DKDVKYYTLEEIQKH HHHCCEEEHHHHHHC | 25.30 | 29176673 | |
| 19 | Acetylation | YTLEEIQKHKDSKST EEHHHHHHCCCCCCE | 59.28 | 23806337 | |
| 19 | Ubiquitination | YTLEEIQKHKDSKST EEHHHHHHCCCCCCE | 59.28 | - | |
| 19 | Malonylation | YTLEEIQKHKDSKST EEHHHHHHCCCCCCE | 59.28 | 26320211 | |
| 24 | Ubiquitination | IQKHKDSKSTWVILH HHHCCCCCCEEEEEE | 63.14 | - | |
| 24 | Malonylation | IQKHKDSKSTWVILH HHHCCCCCCEEEEEE | 63.14 | 26073543 | |
| 33 | Acetylation | TWVILHHKVYDLTKF EEEEEEHHHHHHHHH | 31.57 | 21728379 | |
| 33 | Malonylation | TWVILHHKVYDLTKF EEEEEEHHHHHHHHH | 31.57 | 26073543 | |
| 39 | Malonylation | HKVYDLTKFLEEHPG HHHHHHHHHHHHCCC | 56.07 | 26073543 | |
| 39 | Ubiquitination | HKVYDLTKFLEEHPG HHHHHHHHHHHHCCC | 56.07 | - | |
| 39 | Acetylation | HKVYDLTKFLEEHPG HHHHHHHHHHHHCCC | 56.07 | 23864654 | |
| 60 | Phosphorylation | EQAGGDATENFEDVG HHHCCCCCCCHHHCC | 35.88 | 26525534 | |
| 69 | Phosphorylation | NFEDVGHSTDARELS CHHHCCCCCCHHHHH | 23.27 | 23684622 | |
| 70 | Phosphorylation | FEDVGHSTDARELSK HHHCCCCCCHHHHHC | 28.18 | 26525534 | |
| 77 | Malonylation | TDARELSKTYIIGEL CCHHHHHCEEEEEEE | 58.95 | 26320211 | |
| 77 | Ubiquitination | TDARELSKTYIIGEL CCHHHHHCEEEEEEE | 58.95 | - | |
| 77 | Acetylation | TDARELSKTYIIGEL CCHHHHHCEEEEEEE | 58.95 | 23864654 | |
| 90 | Phosphorylation | ELHPDDRSKIAKPSD EECCCCHHHCCCCCC | 35.09 | 29514104 | |
| 96 | Phosphorylation | RSKIAKPSDTLITTV HHHCCCCCCCEEEEE | 42.39 | 29895711 | |
| 111 | Phosphorylation | ESNSSWWTNWVIPAI CCCCCHHHCCHHHHH | 16.97 | 29895711 | |
| 127 | Phosphorylation | ALAVALMYRLYMAED HHHHHHHHHHHHCCC | 9.79 | 29895711 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYB5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYB5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYB5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CYB5_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Substrate and functional diversity of lysine acetylation revealed bya proteomics survey."; Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.; Mol. Cell 23:607-618(2006). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-19, AND MASS SPECTROMETRY. | |