HPCA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HPCA_HUMAN
• UniProt AC: P84074
• Protein Name: Neuron-specific calcium-binding protein hippocalcin {ECO:0000305}
• Gene Name: HPCA {ECO:0000312|HGNC:HGNC:5144}
• Organism: Homo sapiens (Human).
• Sequence Length: 193
• Subcellular Localization: Cytoplasm, cytosol . Membrane ; Peripheral membrane protein . Association with membranes is calcium-dependent (By similarity). Enriched in the perinuclear region, probably at the trans Golgi network in response to calcium (PubMed:28398555).
• Protein Description: Calcium-binding protein that may play a role in the regulation of voltage-dependent calcium channels. [PubMed: 28398555 May also play a role in cyclic-nucleotide-mediated signaling through the regulation of adenylate and guanylate cyclases (By similarity]
• Protein Sequence: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGKQNSKLR ------CCCCCCCCC	40.01	-
2	N-myristoyl glycine	------MGKQNSKLR ------CCCCCCCCC	40.01	-
20	Phosphorylation	LQDLRENTEFSELEL HHHHHHCCCCHHHHH	33.38	23663014
23	Phosphorylation	LRENTEFSELELQEW HHHCCCCHHHHHHHH	34.73	27732954
31	Phosphorylation	ELELQEWYKGFLKDC HHHHHHHHHHHHHCC	10.65	23663014
36	Ubiquitination	EWYKGFLKDCPTGIL HHHHHHHHCCCCCCC	55.83	30230243
49	Ubiquitination	ILNVDEFKKIYANFF CCCHHHHHHHHHHCC	35.89	30230243
50	Ubiquitination	LNVDEFKKIYANFFP CCHHHHHHHHHHCCC	46.39	33845483
52	Phosphorylation	VDEFKKIYANFFPYG HHHHHHHHHHCCCCC	12.36	-
63	Ubiquitination	FPYGDASKFAEHVFR CCCCCHHHHHHHHHH	50.76	21906983
71	Phosphorylation	FAEHVFRTFDTNSDG HHHHHHHHCCCCCCC	17.88	23898821
74	Phosphorylation	HVFRTFDTNSDGTID HHHHHCCCCCCCCEE	32.22	23898821
76	Phosphorylation	FRTFDTNSDGTIDFR HHHCCCCCCCCEEHH	39.24	23898821
79	Phosphorylation	FDTNSDGTIDFREFI CCCCCCCCEEHHHHH	23.51	23898821
115	Phosphorylation	YDLDGNGYISREEML EECCCCCCCCHHHHH	10.34	22817900
129	Phosphorylation	LEIVQAIYKMVSSVM HHHHHHHHHHHHHHH	8.96	29759185
137	Ubiquitination	KMVSSVMKMPEDEST HHHHHHHCCCCCCCC	49.50	21906983
143	Phosphorylation	MKMPEDESTPEKRTE HCCCCCCCCCHHHHH	62.68	29255136
144	Phosphorylation	KMPEDESTPEKRTEK CCCCCCCCCHHHHHH	33.16	29255136
147	Ubiquitination	EDESTPEKRTEKIFR CCCCCCHHHHHHHHH	66.86	32142685
158	Phosphorylation	KIFRQMDTNNDGKLS HHHHHCCCCCCCCCC	30.49	29978859
163	Ubiquitination	MDTNNDGKLSLEEFI CCCCCCCCCCHHHHH	37.45	24816145
174	Ubiquitination	EEFIRGAKSDPSIVR HHHHHHCCCCHHHHH	59.21	33845483
175	Phosphorylation	EFIRGAKSDPSIVRL HHHHHCCCCHHHHHH	54.97	26657352
178	Phosphorylation	RGAKSDPSIVRLLQC HHCCCCHHHHHHHCC	38.41	27251275
191	Phosphorylation	QCDPSSASQF----- CCCCCCCCCC-----	33.78	17525332

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HPCA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HPCA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HPCA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BIRC1_HUMAN	NAIP	physical	10899114

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 224500: Dystonia 2, torsion, autosomal recessive (DYT2)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.