dbPTM

HIS3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HIS3_HUMAN
UniProt AC	P15516
Protein Name	Histatin-3
Gene Name	HTN3
Organism	Homo sapiens (Human).
Sequence Length	51
Subcellular Localization	Secreted . Secreted by serous acinar and demilune cells.
Protein Description	Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities. His3-(20-43)-peptide (histatin-5) is especially effective against C.albicans and C.neoformans, and inhibits Lys-gingipain and Arg-gingipain (rgpB) from P.gingivalis. In addition, His3-(20-43)-peptide is a potent inhibitor of metalloproteinases MMP2 and MMP9..
Protein Sequence	MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	LILALMLSMTGADSH HHHHHHHHHHCCHHH	10.59	24043423
17	Phosphorylation	LALMLSMTGADSHAK HHHHHHHHCCHHHHH	26.33	24043423
21	Phosphorylation	LSMTGADSHAKRHHG HHHHCCHHHHHHHCC	25.47	24043423
45	Phosphorylation	HSHRGYRSNYLYDN- HCCCCCCHHCCCCC-	22.73	21299198

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HIS3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HIS3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HIS3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
HSP7C_HUMAN	HSPA8	physical	26775844

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HIS3_HUMAN

Related Literatures of Post-Translational Modification