HIP26_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HIP26_ARATH
• UniProt AC: Q9SZN7
• Protein Name: Heavy metal-associated isoprenylated plant protein 26 {ECO:0000303|PubMed:21072340, ECO:0000303|PubMed:23368984}
• Gene Name: HIPP26 {ECO:0000303|PubMed:21072340, ECO:0000303|PubMed:23368984}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 153
• Subcellular Localization: Nucleus membrane . Cell membrane . PubMed:18974936 shows that isopernylation may be important for a speckle-like nuclear localization in a heterologous system, while PubMed:18823312 shows a plasma membrane localization.
• Protein Description: Heavy-metal-binding protein. Binds lead, cadmium and copper. May be involved in heavy-metal transport. [PubMed: 18823312 May be involved in cadmium transport and play a role in cadmium detoxification]
• Protein Sequence: MGVLDHVSEMFDCSHGHKIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTLEPKAHKVTVVGYVDPNKVVARMSHRTGKKVELWPYVPYDVVAHPYAAGVYDKKAPSGYVRRVDDPGVSQLARASSTEVRYTTAFSDENPAACVVM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	KKRKQLQTVEIKVKM CCCCCCCEEEEEEEE	28.79	23776212
55	Phosphorylation	EGMKGVSSVTLEPKA CCCCCCCEEEECCCC	19.40	28295753
57	Phosphorylation	MKGVSSVTLEPKAHK CCCCCEEEECCCCEE	27.61	28295753
114	Phosphorylation	VYDKKAPSGYVRRVD CCCCCCCCCCEEECC	47.84	25561503
116	Phosphorylation	DKKAPSGYVRRVDDP CCCCCCCCEEECCCC	8.63	25561503
126	Phosphorylation	RVDDPGVSQLARASS ECCCCCHHHHHHHCC	25.95	17317660
132	Phosphorylation	VSQLARASSTEVRYT HHHHHHHCCCEEEEE	32.04	28011693
133	Phosphorylation	SQLARASSTEVRYTT HHHHHHCCCEEEEEE	27.83	27545962
150	Farnesylation	SDENPAACVVM---- CCCCCCCEEEC----	2.29	18974936
150	Methylation	SDENPAACVVM---- CCCCCCCEEEC----	2.29	18974936
150	Farnesylation	SDENPAACVVM---- CCCCCCCEEEC----	2.29	18974936

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HIP26_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HIP26_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HIP26_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZHD11_ARATH	ZFHD1	physical	18974936

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.