HES1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HES1_RAT
• UniProt AC: Q04666
• Protein Name: Transcription factor HES-1
• Gene Name: Hes1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 281
• Subcellular Localization: Nucleus.
• Protein Description: Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity)..
• Protein Sequence: MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPGGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPWRN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	ADIMEKNSSSPVAAT HHHHCCCCCCCCCCC	43.17	27097102
11	Phosphorylation	DIMEKNSSSPVAATP HHHCCCCCCCCCCCC	48.32	27097102
12	Phosphorylation	IMEKNSSSPVAATPA HHCCCCCCCCCCCCC	24.18	27097102
17	Phosphorylation	SSSPVAATPASVNTT CCCCCCCCCCCCCCC	15.06	27097102
20	Phosphorylation	PVAATPASVNTTPDK CCCCCCCCCCCCCCC	19.66	27097102
23	Phosphorylation	ATPASVNTTPDKPKT CCCCCCCCCCCCCCC	37.23	27097102
24	Phosphorylation	TPASVNTTPDKPKTA CCCCCCCCCCCCCCH	25.04	27097102
263	Phosphorylation	SVGPNAVSPSSGSSL CCCCCCCCCCCCCCC	19.36	22302822

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
263	S	Phosphorylation	Kinase	MAPK8	P45983	GPS
263	S	Phosphorylation	Kinase	MAPK9	P45984	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HES1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HES1_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PARP1_RAT	Parp1	physical	15607978
SRC_RAT	Src	physical	15607978
KCC2A_RAT	Camk2a	physical	15607978

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.