UniProt ID | HBAT_HUMAN | |
---|---|---|
UniProt AC | P09105 | |
Protein Name | Hemoglobin subunit theta-1 | |
Gene Name | HBQ1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 142 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MALSAEDRALV ----CCCCHHHHHHH | 21.77 | 26270265 | |
17 | Ubiquitination | LVRALWKKLGSNVGV HHHHHHHHHCCCCEE | 46.64 | - | |
43 | Phosphorylation | AFPATKTYFSHLDLS HCCCCCCHHHCCCCC | 12.49 | 18491316 | |
50 | Phosphorylation | YFSHLDLSPGSSQVR HHHCCCCCCCCHHHH | 27.21 | 18491316 | |
53 | Phosphorylation | HLDLSPGSSQVRAHG CCCCCCCCHHHHHHH | 22.45 | 18491316 | |
62 | Ubiquitination | QVRAHGQKVADALSL HHHHHHHHHHHHHHH | 43.94 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBAT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBAT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBAT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RFESD_HUMAN | RFESD | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...