| UniProt ID | HBAT_HUMAN | |
|---|---|---|
| UniProt AC | P09105 | |
| Protein Name | Hemoglobin subunit theta-1 | |
| Gene Name | HBQ1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 142 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MALSAEDRALV ----CCCCHHHHHHH | 21.77 | 26270265 | |
| 17 | Ubiquitination | LVRALWKKLGSNVGV HHHHHHHHHCCCCEE | 46.64 | - | |
| 43 | Phosphorylation | AFPATKTYFSHLDLS HCCCCCCHHHCCCCC | 12.49 | 18491316 | |
| 50 | Phosphorylation | YFSHLDLSPGSSQVR HHHCCCCCCCCHHHH | 27.21 | 18491316 | |
| 53 | Phosphorylation | HLDLSPGSSQVRAHG CCCCCCCCHHHHHHH | 22.45 | 18491316 | |
| 62 | Ubiquitination | QVRAHGQKVADALSL HHHHHHHHHHHHHHH | 43.94 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBAT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBAT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBAT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RFESD_HUMAN | RFESD | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...