| UniProt ID | RFESD_HUMAN | |
|---|---|---|
| UniProt AC | Q8TAC1 | |
| Protein Name | Rieske domain-containing protein | |
| Gene Name | RFESD | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 157 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MNLDGSAQDPEKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGIKQRIHTVTVDNGNIYVTLSNEPFKCDSDFYATGDFKVIKSSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNLDGSAQ -------CCCCCCCC | 11.52 | 22814378 | |
| 6 | Phosphorylation | --MNLDGSAQDPEKR --CCCCCCCCCHHHC | 23.56 | 23186163 | |
| 15 | Phosphorylation | QDPEKREYSSVCVGR CCHHHCCCCEEEECC | 15.41 | 20562096 | |
| 16 | Phosphorylation | DPEKREYSSVCVGRE CHHHCCCCEEEECCH | 16.13 | 20562096 | |
| 27 | Acetylation | VGREDDIKKSERMTA ECCHHHCCHHHCEEE | 58.19 | 30591867 | |
| 45 | Phosphorylation | DREVVIFYHKGEYHA CCEEEEEEECCCEEE | 7.47 | - | |
| 88 | Phosphorylation | PWHKYKITLATGEGL CCCEEEEEEEECCCH | 13.24 | 25907765 | |
| 91 | Phosphorylation | KYKITLATGEGLYQS EEEEEEEECCCHHHC | 38.59 | 25907765 | |
| 96 | Phosphorylation | LATGEGLYQSINPKD EEECCCHHHCCCCCC | 15.86 | 25907765 | |
| 98 | Phosphorylation | TGEGLYQSINPKDPS ECCCHHHCCCCCCCC | 15.69 | 25907765 | |
| 123 | Phosphorylation | KQRIHTVTVDNGNIY CCCEEEEEEECCEEE | 24.25 | 29116813 | |
| 130 | Phosphorylation | TVDNGNIYVTLSNEP EEECCEEEEEECCCC | 7.44 | 29116813 | |
| 132 | Phosphorylation | DNGNIYVTLSNEPFK ECCEEEEEECCCCEE | 13.90 | 29116813 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFESD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFESD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFESD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RFESD_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...