HAND1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HAND1_HUMAN
• UniProt AC: O96004
• Protein Name: Heart- and neural crest derivatives-expressed protein 1
• Gene Name: HAND1
• Organism: Homo sapiens (Human).
• Sequence Length: 215
• Subcellular Localization: Nucleus, nucleoplasm. Nucleus, nucleolus. Interaction with MDFIC sequesters it into the nucleolus, preventing the transcription factor activity. Phosphorylation by PLK4 disrupts the interaction with MDFIC and releases it from the nucleolus, leading t
• Protein Description: Transcription factor that plays an essential role in both trophoblast-giant cells differentiation and in cardiac morphogenesis. In the adult, could be required for ongoing expression of cardiac-specific genes. Binds the DNA sequence 5'-NRTCTG-3' (non-canonical E-box) (By similarity)..
• Protein Sequence: MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
98	Phosphorylation	RLGRRKGSGPKKERR HHHHCCCCCCHHHHH	55.76	14636580
107	Dephosphorylation	PKKERRRTESINSAF CHHHHHHHHHHHHHH	32.07	14636580
107	Phosphorylation	PKKERRRTESINSAF CHHHHHHHHHHHHHH	32.07	14636580
109	Dephosphorylation	KERRRTESINSAFAE HHHHHHHHHHHHHHH	26.85	14636580
109	Phosphorylation	KERRRTESINSAFAE HHHHHHHHHHHHHHH	26.85	14636580
163	Sumoylation	SGDPEAFKAELKKAD CCCHHHHHHHHHHHC	48.26	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
98	S	Phosphorylation	Kinase	PKA-FAMILY	-	GPS
98	S	Phosphorylation	Kinase	PKC-FAMILY	-	GPS
98	S	Phosphorylation	Kinase	PKA_GROUP	-	PhosphoELM
98	S	Phosphorylation	Kinase	PKC_GROUP	-	PhosphoELM
107	T	Phosphorylation	Kinase	PLK4	O00444	Uniprot
107	T	Phosphorylation	Kinase	PKA-FAMILY	-	GPS
107	T	Phosphorylation	Kinase	PKC-FAMILY	-	GPS
107	T	Phosphorylation	Kinase	PKA_GROUP	-	PhosphoELM
107	T	Phosphorylation	Kinase	PKC_GROUP	-	PhosphoELM
109	S	Phosphorylation	Kinase	PLK4	O00444	Uniprot
109	S	Phosphorylation	Kinase	PKA-FAMILY	-	GPS
109	S	Phosphorylation	Kinase	PKC-FAMILY	-	GPS
109	S	Phosphorylation	Kinase	PKA_GROUP	-	PhosphoELM
109	S	Phosphorylation	Kinase	PKC_GROUP	-	PhosphoELM
-	K	Ubiquitination	E3 ubiquitin ligase	FBXO25	Q8TCJ0	PMID:24658274

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HAND1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HAND1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HEY2_HUMAN	HEY2	physical	10924525
HEYL_HUMAN	HEYL	physical	10924525
SRA1_HUMAN	SRA1	physical	20398657
MEF2A_HUMAN	MEF2A	physical	16043483
TFE2_HUMAN	TCF3	physical	16043483

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.