HACD_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HACD_ARATH
• UniProt AC: Q8VZB2
• Protein Name: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 {ECO:0000305}
• Gene Name: PAS2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 221
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Cytoplasm . Nucleus . Found in the cytoplasm of dividing cells but moves into the nucleus upon cell differentiation.
• Protein Description: Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May be an anti-phosphatase that prevents CDKA-1 dephosphorylation and activation. Involved in the hormonal control of cell division and differentiation. Required for proliferation control of meristematic and non-meristematic cells. Negative regulator of the cell cycle..
• Protein Sequence: MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVLEILHGLVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYSFFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of HACD_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HACD_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HACD_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HACD_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKA1_ARATH	CDC2	physical	16698944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.