UniProt ID | H4G_HUMAN | |
---|---|---|
UniProt AC | Q99525 | |
Protein Name | Histone H4-like protein type G | |
Gene Name | HIST1H4G | |
Organism | Homo sapiens (Human). | |
Sequence Length | 98 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity).. | |
Protein Sequence | MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Acetylation | --MSVRGKAGKGLGK --CCCCCCCCCCCCC | 43.32 | 16916647 | |
9 | Acetylation | SVRGKAGKGLGKGGA CCCCCCCCCCCCCHH | 56.68 | 16916647 | |
13 | Acetylation | KAGKGLGKGGAKCHR CCCCCCCCCHHHHHH | 60.25 | 16916647 | |
13 | Ubiquitination | KAGKGLGKGGAKCHR CCCCCCCCCHHHHHH | 60.25 | 33845483 | |
17 | Acetylation | GLGKGGAKCHRKVLS CCCCCHHHHHHHHHH | 33.57 | 25953088 | |
24 | Phosphorylation | KCHRKVLSDNIQGIT HHHHHHHHCCCCCHH | 31.44 | 23898821 | |
31 | Phosphorylation | SDNIQGITKCTIRRL HCCCCCHHHHHHHHH | 27.22 | 20164059 | |
52 | Phosphorylation | KRILGLIYEETRRVF HHHHHHHHHHHHHHH | 16.86 | - | |
78 | Ubiquitination | VTNTEHAKRKTVTAM HHCCHHHCHHHHHHH | 57.23 | 22817900 | |
80 | Ubiquitination | NTEHAKRKTVTAMAV CCHHHCHHHHHHHHH | 46.79 | 22817900 | |
89 | Phosphorylation | VTAMAVVYVLKRQGR HHHHHHHHHHHHCCC | 8.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H4G_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H4G_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H4G_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATRAP_HUMAN | AGTRAP | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...