| UniProt ID | GSTA4_HUMAN | |
|---|---|---|
| UniProt AC | O15217 | |
| Protein Name | Glutathione S-transferase A4 | |
| Gene Name | GSTA4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 222 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).. | |
| Protein Sequence | MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MAARPKLH -------CCCCCCCC | 6.25 | - | |
| 34 | Ubiquitination | GVEFDEEFLETKEQL CCCCCHHHHHHHHHH | 7.60 | 21890473 | |
| 45 | Ubiquitination | KEQLYKLQDGNHLLF HHHHHCCCCCCEEEE | 53.03 | 21890473 | |
| 84 | Ubiquitination | DKHNLFGKNLKERTL HHCCCCCCCCHHHHH | 52.34 | - | |
| 127 | Ubiquitination | EVVNMAQKAIIRYFP HHHHHHHHHHHHHHH | 31.82 | 21890473 | |
| 138 | Ubiquitination | RYFPVFEKILRGHGQ HHHHHHHHHHCCCCC | 35.26 | 21890473 | |
| 189 | Phosphorylation | QEYTVKLSNIPTIKR HHHHHHHHCCCCHHH | 27.31 | 12646569 | |
| 193 | Phosphorylation | VKLSNIPTIKRFLEP HHHHCCCCHHHHCCC | 35.02 | 12646569 | |
| 202 | Phosphorylation | KRFLEPGSKKKPPPD HHHCCCCCCCCCCCC | 52.60 | 27251275 | |
| 203 | Ubiquitination | RFLEPGSKKKPPPDE HHCCCCCCCCCCCCC | 71.39 | - | |
| 204 | Ubiquitination | FLEPGSKKKPPPDEI HCCCCCCCCCCCCCC | 72.68 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTA4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTA4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GSTA4_HUMAN | GSTA4 | physical | 16189514 | |
| GSTA4_HUMAN | GSTA4 | physical | 25416956 | |
| CB050_HUMAN | C2orf50 | physical | 25416956 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00143 | Glutathione |
loading...