UniProt ID | GSTA4_HUMAN | |
---|---|---|
UniProt AC | O15217 | |
Protein Name | Glutathione S-transferase A4 | |
Gene Name | GSTA4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 222 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).. | |
Protein Sequence | MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MAARPKLH -------CCCCCCCC | 6.25 | - | |
34 | Ubiquitination | GVEFDEEFLETKEQL CCCCCHHHHHHHHHH | 7.60 | 21890473 | |
45 | Ubiquitination | KEQLYKLQDGNHLLF HHHHHCCCCCCEEEE | 53.03 | 21890473 | |
84 | Ubiquitination | DKHNLFGKNLKERTL HHCCCCCCCCHHHHH | 52.34 | - | |
127 | Ubiquitination | EVVNMAQKAIIRYFP HHHHHHHHHHHHHHH | 31.82 | 21890473 | |
138 | Ubiquitination | RYFPVFEKILRGHGQ HHHHHHHHHHCCCCC | 35.26 | 21890473 | |
189 | Phosphorylation | QEYTVKLSNIPTIKR HHHHHHHHCCCCHHH | 27.31 | 12646569 | |
193 | Phosphorylation | VKLSNIPTIKRFLEP HHHHCCCCHHHHCCC | 35.02 | 12646569 | |
202 | Phosphorylation | KRFLEPGSKKKPPPD HHHCCCCCCCCCCCC | 52.60 | 27251275 | |
203 | Ubiquitination | RFLEPGSKKKPPPDE HHCCCCCCCCCCCCC | 71.39 | - | |
204 | Ubiquitination | FLEPGSKKKPPPDEI HCCCCCCCCCCCCCC | 72.68 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTA4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTA4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GSTA4_HUMAN | GSTA4 | physical | 16189514 | |
GSTA4_HUMAN | GSTA4 | physical | 25416956 | |
CB050_HUMAN | C2orf50 | physical | 25416956 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00143 | Glutathione |
loading...