dbPTM

GRXS9_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GRXS9_ARATH
UniProt AC	O04341
Protein Name	Monothiol glutaredoxin-S9
Gene Name	GRXS9
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	102
Subcellular Localization	Cytoplasm.
Protein Description	May only reduce GSH-thiol disulfides, but not protein disulfides..
Protein Sequence	MDKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPECREIEKALMRLGCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQANLC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of GRXS9_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GRXS9_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GRXS9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GRXS9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BBX19_ARATH	AT4G38960	physical	21798944
TIF8_ARATH	TIFY8	physical	21798944
TGA2_ARATH	AHBP-1B	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GRXS9_ARATH

Related Literatures of Post-Translational Modification