| UniProt ID | GRXC7_ARATH | |
|---|---|---|
| UniProt AC | Q96305 | |
| Protein Name | Glutaredoxin-C7 | |
| Gene Name | GRXC7 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 136 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins (By similarity). Involved in flower development as a regulator of petal primorida initiation and further petal morphogenesis. May mediate post-translational modifications of target proteins required for normal petal organ initiation and morphogenesis. ROXY1/TGA protein interactions can occur in vivo and support their biological relevance in petal development. May be involved in the regulation of the floral regulator class C gene AG (AGAMOUS).. | |
| Protein Sequence | MQYQTESWGSYKMSSLGFGGLGMVADTGLLRIESLASESAVVIFSVSTCCMCHAVKGLFRGMGVSPAVHELDLHPYGGDIQRALIRLLGCSGSSSPGSLPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGALWL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of GRXC7_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRXC7_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRXC7_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRXC7_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TGA2_ARATH | AHBP-1B | physical | 20805327 | |
| PAN_ARATH | PAN | physical | 21960138 | |
| TGA3_ARATH | TGA3 | physical | 21960138 | |
| TGA2_ARATH | AHBP-1B | physical | 19218396 | |
| TGA3_ARATH | TGA3 | physical | 19218396 | |
| TGA7_ARATH | AT1G77920 | physical | 19218396 | |
| PAN_ARATH | PAN | physical | 19218396 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
