GRPE_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRPE_SCHPO
• UniProt AC: O43047
• Protein Name: GrpE protein homolog, mitochondrial
• Gene Name: mge1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 223
• Subcellular Localization: Mitochondrion matrix.
• Protein Description: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of ssc1 to substrate proteins (By similarity)..
• Protein Sequence: MLGLGRVFSSAVRPRTLIRAPINKRSFLWYSTEAAKEEKPAEEKVAETENVDVKELQSKLSELKSKYEAKDKEVAELKGSIRQSLADYRNLENRMKRDMEQTRAFAVQKLTKDLLDSVDNLERALSIVPEEKRNNRESNKDLVDLYEGLAMTESNLMKTLGKYGLVRYDGIGEDFDPNIHEAVFQIPVEGKKPNTVFHCESKGFQLNGRVIRPAKVGVVKGDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GRPE_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRPE_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRPE_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRPE_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GRPE_SCHPO	mge1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.