| UniProt ID | GRP3_ARATH | |
|---|---|---|
| UniProt AC | Q9SL15 | |
| Protein Name | Glycine-rich protein 3 | |
| Gene Name | GRP3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 145 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix . | |
| Protein Description | Regulates the function of the receptor protein kinase WAK1, and namely the phosphorylation of OEE2.. | |
| Protein Sequence | MASKALVLLGLFAVLLVVSEVAAASSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHGCCYRGYNGCSRCCSYAGEAVQTQPGH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 (in isoform 4) | Phosphorylation | - | 37.25 | 30291188 | |
| 36 (in isoform 5) | Phosphorylation | - | 37.25 | 30291188 | |
| 44 | Phosphorylation | VKPDQRGYGDNGGNY CCCCCCCCCCCCCCC | 24.40 | 29797451 | |
| 44 (in isoform 4) | Phosphorylation | - | 24.40 | 30291188 | |
| 44 (in isoform 5) | Phosphorylation | - | 24.40 | 30291188 | |
| 51 | Phosphorylation | YGDNGGNYNNGGGYQ CCCCCCCCCCCCCCC | 17.18 | 29797451 | |
| 51 (in isoform 4) | Phosphorylation | - | 17.18 | 30291188 | |
| 51 (in isoform 5) | Phosphorylation | - | 17.18 | 30291188 | |
| 57 | Phosphorylation | NYNNGGGYQGGGGNY CCCCCCCCCCCCCCC | 13.78 | 29797451 | |
| 57 (in isoform 4) | Phosphorylation | - | 13.78 | 30291188 | |
| 57 (in isoform 5) | Phosphorylation | - | 13.78 | 30291188 | |
| 64 | Phosphorylation | YQGGGGNYQGGGGNY CCCCCCCCCCCCCCC | 16.29 | 29797451 | |
| 71 | Phosphorylation | YQGGGGNYQGGGGNY CCCCCCCCCCCCCCC | 16.29 | 29797451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRP3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRP3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRP3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WAK1_ARATH | WAK1 | physical | 11335717 | |
| P2C70_ARATH | KAPP | physical | 11335717 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
