GROA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GROA_HUMAN
• UniProt AC: P09341
• Protein Name: Growth-regulated alpha protein
• Gene Name: CXCL1
• Organism: Homo sapiens (Human).
• Sequence Length: 107
• Subcellular Localization: Secreted.
• Protein Description: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity..
• Protein Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	GRRAAGASVATELRC HHHHCCCHHHHHHHH	16.03	24505115
90	Phosphorylation	KACLNPASPIVKKII HHHCCCCCHHHHHHH	19.20	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GROA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GROA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GROA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACKR1_HUMAN	ACKR1	physical	13679391
GROA_HUMAN	CXCL1	physical	8397104

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.