UniProt ID | GPX8_HUMAN | |
---|---|---|
UniProt AC | Q8TED1 | |
Protein Name | Probable glutathione peroxidase 8 | |
Gene Name | GPX8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 209 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWKPEEPIEVIRPDIAALVRQVIIKKKEDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEPLAAYP -------CCCCCCCC | 12.35 | 22814378 | |
10 | Ubiquitination | PLAAYPLKCSGPRAK CCCCCCCCCCCHHHH | 23.11 | - | |
53 | Ubiquitination | SFYAFEVKDAKGRTV EEEEEEEECCCCCEE | 44.78 | - | |
61 | Phosphorylation | DAKGRTVSLEKYKGK CCCCCEEEEEEECCE | 30.14 | 27251275 | |
64 | Ubiquitination | GRTVSLEKYKGKVSL CCEEEEEEECCEEEE | 58.52 | - | |
90 | Ubiquitination | DRNYLGLKELHKEFG CCCCCCHHHHHHHHC | 57.33 | - | |
90 | Acetylation | DRNYLGLKELHKEFG CCCCCCHHHHHHHHC | 57.33 | 27452117 | |
94 | Ubiquitination | LGLKELHKEFGPSHF CCHHHHHHHHCCCCE | 68.32 | - | |
94 | Acetylation | LGLKELHKEFGPSHF CCHHHHHHHHCCCCE | 68.32 | 26051181 | |
120 | Ubiquitination | ESEPRPSKEVESFAR CCCCCCCHHHHHHHH | 69.34 | - | |
128 | Ubiquitination | EVESFARKNYGVTFP HHHHHHHHHCCCCCE | 51.60 | 21890473 | |
130 | Phosphorylation | ESFARKNYGVTFPIF HHHHHHHCCCCCEEE | 18.93 | 28152594 | |
141 | Ubiquitination | FPIFHKIKILGSEGE CEEEEEEEEECCCCC | 36.36 | - | |
159 | Ubiquitination | RFLVDSSKKEPRWNF EHEECCCCCCCCCCH | 66.17 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPX8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPX8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPX8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
G3PT_HUMAN | GAPDHS | physical | 26186194 | |
G3PT_HUMAN | GAPDHS | physical | 28514442 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00143 | Glutathione |
loading...