GPSM3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GPSM3_HUMAN
• UniProt AC: Q9Y4H4
• Protein Name: G-protein-signaling modulator 3
• Gene Name: GPSM3
• Organism: Homo sapiens (Human).
• Sequence Length: 160
• Subcellular Localization: Cytoplasm .
• Protein Description: Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins..
• Protein Sequence: MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Phosphorylation	EGWPPPNSTTRPWRS CCCCCCCCCCCCCCC	36.61	26074081
29	Phosphorylation	GWPPPNSTTRPWRSA CCCCCCCCCCCCCCC	33.20	26074081
30	Phosphorylation	WPPPNSTTRPWRSAP CCCCCCCCCCCCCCC	34.26	26074081
35	Phosphorylation	STTRPWRSAPPSPPP CCCCCCCCCCCCCCC	41.06	23401153
39	Phosphorylation	PWRSAPPSPPPPGTR CCCCCCCCCCCCCCC	49.32	23401153
45	Phosphorylation	PSPPPPGTRHTALGP CCCCCCCCCCCCCCH	25.67	23403867
48	Phosphorylation	PPPGTRHTALGPRSA CCCCCCCCCCCHHHH	21.93	26074081
54	Phosphorylation	HTALGPRSASLLSLQ CCCCCHHHHHHHHHH	25.91	26846344
56	Phosphorylation	ALGPRSASLLSLQTE CCCHHHHHHHHHHHH	30.96	26846344
59	Phosphorylation	PRSASLLSLQTELLL HHHHHHHHHHHHHHH	24.59	26846344
62	Phosphorylation	ASLLSLQTELLLDLV HHHHHHHHHHHHHHH	33.62	26846344
74	Phosphorylation	DLVAEAQSRRLEEQR HHHHHHHHHHHHHHH	26.81	27080861
83	Phosphorylation	RLEEQRATFYTPQNP HHHHHHCCCCCCCCH	21.26	29978859
85	Phosphorylation	EEQRATFYTPQNPSS HHHHCCCCCCCCHHH	17.10	28796482
86	Phosphorylation	EQRATFYTPQNPSSL HHHCCCCCCCCHHHC	17.76	23532336
108	Phosphorylation	LEDREQLYSTILSHQ CCCHHHHHHHHHHHH	11.94	29978859
109	Phosphorylation	EDREQLYSTILSHQC CCHHHHHHHHHHHHH	19.98	26552605
110	Phosphorylation	DREQLYSTILSHQCQ CHHHHHHHHHHHHHH	16.63	26552605
113	Phosphorylation	QLYSTILSHQCQRME HHHHHHHHHHHHHHH	13.99	26552605

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
35	S	Phosphorylation	Kinase	GSK3A	P49840	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GPSM3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GPSM3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
USBP1_HUMAN	USHBP1	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.