UniProt ID | GPR3_HUMAN | |
---|---|---|
UniProt AC | P46089 | |
Protein Name | G-protein coupled receptor 3 | |
Gene Name | GPR3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 330 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Has a potential role in modulating a number of brain functions, including behavioral responses to stress (By similarity), amyloid-beta peptide generation in neurons and neurite outgrowth (By similarity). Maintains also meiotic arrest in oocytes (By similarity).. | |
Protein Sequence | MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | N-linked_Glycosylation | SAGSGNVNVSSVGPA CCCCCCEECEEECCC | 31.77 | UniProtKB CARBOHYD | |
39 | Phosphorylation | GPAAPLPSPKAWDVV CCCCCCCCCCCCEEE | 46.87 | 24719451 | |
237 | Phosphorylation | QRHLLPASHYVATRK HHCCCCHHHHHHHHC | 17.26 | - | |
313 | S-palmitoylation | KVLWAVCCCCSSSKI HHHHHHHHHCCCCCC | 1.79 | - | |
324 | Phosphorylation | SSKIPFRSRSPSDV- CCCCCCCCCCCCCC- | 37.17 | - | |
326 | Phosphorylation | KIPFRSRSPSDV--- CCCCCCCCCCCC--- | 29.96 | - | |
328 | Phosphorylation | PFRSRSPSDV----- CCCCCCCCCC----- | 52.86 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPR3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPR3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPR3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TMEM5_HUMAN | TMEM5 | physical | 21988832 | |
ZN593_HUMAN | ZNF593 | physical | 21988832 | |
DMWD_HUMAN | DMWD | physical | 26186194 | |
DMWD_HUMAN | DMWD | physical | 28514442 | |
APOD_HUMAN | APOD | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...