GPR15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GPR15_HUMAN
• UniProt AC: P49685
• Protein Name: G-protein coupled receptor 15
• Gene Name: GPR15
• Organism: Homo sapiens (Human).
• Sequence Length: 360
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Probable chemokine receptor. Alternative coreceptor with CD4 for HIV-1 infection..
• Protein Sequence: MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
324	Phosphorylation	LCPCLKNYDFGSSTE HHHHHCCCCCCCCCC	15.86	27080861
328	Phosphorylation	LKNYDFGSSTETSDS HCCCCCCCCCCCCHH	33.80	30108239
329	Phosphorylation	KNYDFGSSTETSDSH CCCCCCCCCCCCHHH	30.55	30108239
330	Phosphorylation	NYDFGSSTETSDSHL CCCCCCCCCCCHHHH	45.00	27080861
332	Phosphorylation	DFGSSTETSDSHLTK CCCCCCCCCHHHHHH	37.61	27080861
333	Phosphorylation	FGSSTETSDSHLTKA CCCCCCCCHHHHHHH	30.77	27422710
335	Phosphorylation	SSTETSDSHLTKALS CCCCCCHHHHHHHHH	21.84	27080861
338	Phosphorylation	ETSDSHLTKALSTFI CCCHHHHHHHHHHHH	14.62	27080861
342	Phosphorylation	SHLTKALSTFIHAED HHHHHHHHHHHHHHH	26.57	27422710
343	Phosphorylation	HLTKALSTFIHAEDF HHHHHHHHHHHHHHH	27.71	30108239
357	Phosphorylation	FARRRKRSVSL---- HHHHHHHHCCC----	21.06	27282143
359	O-linked_Glycosylation	RRRKRSVSL------ HHHHHHCCC------	29.61	35474999
359	Phosphorylation	RRRKRSVSL------ HHHHHHCCC------	29.61	21189250

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
357	S	Phosphorylation	Kinase	PRKACA	P17612	GPS
357	S	Phosphorylation	Kinase	PRKCA	P17252	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GPR15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GPR15_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
1433B_HUMAN	YWHAB	physical	23772394

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.