UniProt ID | GPR12_HUMAN | |
---|---|---|
UniProt AC | P47775 | |
Protein Name | G-protein coupled receptor 12 | |
Gene Name | GPR12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 334 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
Protein Description | Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity). Receptor with constitutive G(s) signaling activity that stimulates cyclic AMP production.. | |
Protein Sequence | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | N-linked_Glycosylation | MNEDLKVNLSGLPRD CCCCCCCCCCCCCHH | 27.23 | UniProtKB CARBOHYD | |
24 | N-linked_Glycosylation | LDAAAAENISAAVSS HHHHHHHCHHHHHHC | 28.87 | UniProtKB CARBOHYD | |
243 | Phosphorylation | HFLATSHYVTTRKGV HHHHCCCCCCCCCCH | 10.16 | - | |
317 | S-palmitoylation | KALCLICCGCIPSSL HHHHHHHHCCCHHHH | 3.85 | - | |
330 | Phosphorylation | SLAQRARSPSDV--- HHHHHCCCCCCC--- | 27.98 | - | |
332 | Phosphorylation | AQRARSPSDV----- HHHCCCCCCC----- | 52.86 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPR12_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPR12_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPR12_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...