UniProt ID | GMPR1_HUMAN | |
---|---|---|
UniProt AC | P36959 | |
Protein Name | GMP reductase 1 {ECO:0000255|HAMAP-Rule:MF_03195} | |
Gene Name | GMPR | |
Organism | Homo sapiens (Human). | |
Sequence Length | 345 | |
Subcellular Localization | ||
Protein Description | Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.. | |
Protein Sequence | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Malonylation | ADLKLDFKDVLLRPK CCCCCCHHHHHHCCC | 46.74 | 26320211 | |
13 | Ubiquitination | ADLKLDFKDVLLRPK CCCCCCHHHHHHCCC | 46.74 | 29967540 | |
13 | Acetylation | ADLKLDFKDVLLRPK CCCCCCHHHHHHCCC | 46.74 | 25953088 | |
20 | Ubiquitination | KDVLLRPKRSSLKSR HHHHHCCCCCCCCCC | 59.48 | - | |
37 | Phosphorylation | VDLERTFTFRNSKQT ECCEEEEEECCCCCE | 22.52 | - | |
81 | Phosphorylation | TAIHKHYSLDDWKLF HHHHCCCCCCHHHHE | 25.66 | - | |
267 | Phosphorylation | GRKLKLFYGMSSDTA CCEEEEEEECCCHHH | 23.50 | 22817900 | |
270 | Phosphorylation | LKLFYGMSSDTAMNK EEEEEECCCHHHHHH | 22.24 | 27251275 | |
271 | Phosphorylation | KLFYGMSSDTAMNKH EEEEECCCHHHHHHH | 30.04 | 27251275 | |
273 | Phosphorylation | FYGMSSDTAMNKHAG EEECCCHHHHHHHCC | 29.74 | 27251275 | |
314 | Phosphorylation | DILGGLRSTCTYVGA HHHHHHHHHCCHHCH | 32.64 | 21406692 | |
315 | Phosphorylation | ILGGLRSTCTYVGAA HHHHHHHHCCHHCHH | 11.48 | 21406692 | |
317 | Phosphorylation | GGLRSTCTYVGAAKL HHHHHHCCHHCHHHH | 22.72 | 21406692 | |
318 | Phosphorylation | GLRSTCTYVGAAKLK HHHHHCCHHCHHHHH | 10.07 | 28152594 | |
318 | Nitration | GLRSTCTYVGAAKLK HHHHHCCHHCHHHHH | 10.07 | - | |
323 | Acetylation | CTYVGAAKLKELSRR CCHHCHHHHHHHHHH | 60.60 | 25953088 | |
332 | Phosphorylation | KELSRRATFIRVTQQ HHHHHHCCEEEEHHH | 20.13 | 23186163 | |
345 | Phosphorylation | QQHNTVFS------- HHCCCCCC------- | 34.67 | 22617229 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GMPR1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GMPR1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GMPR1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GMPR1_HUMAN | GMPR | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...