GMH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GMH1_SCHPO
• UniProt AC: Q09679
• Protein Name: Probable alpha-1,2-galactosyltransferase gmh1
• Gene Name: gmh1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 329
• Subcellular Localization: Golgi apparatus membrane ; Single-pass type II membrane protein .
• Protein Sequence: MLSFFTKNTLTKRKLIMLALAIVFTFFAFGLYFIPHDEISVFDFKLPALQYETTVTSLDNFLIGGSTTLYTATVNHEDLNEPKSHEIVMLLASDGNVGSFESNLLDDCFKNRIEYAKLQNYNFEFVNVSSLVVPPVWGKMPAILQTMRKYPSAKWIWWLDQDALIMNKNLSLQELFLSPAMLQKSLLREQPIINSFGEDNFRITPAAYSKEMIEQIQFLISQDHNGLNAGSFLVRNSRSIALLMDLLTDPSLADAGVVRHEQDLIGYFIQKHSQVASMVGILPQRFINAFHEGPPTMQWQEGDLALHFAGCWVENKCAELWTKYKDKII

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
127	N-linked_Glycosylation	NYNFEFVNVSSLVVP CCCEEEEECHHEECC	33.02	-
169	N-linked_Glycosylation	DALIMNKNLSLQELF CHHHHCCCCCHHHHH	29.83	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GMH1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GMH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GMH1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GMH2_SCHPO	gmh2	genetic	21098516
GMH3_SCHPO	gmh3	genetic	21098516
YGWH_SCHPO	gmh4	genetic	21098516
YFE6_SCHPO	gmh5	genetic	21098516
YBKD_SCHPO	gmh6	genetic	21098516

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.