UniProt ID | GIMA6_HUMAN | |
---|---|---|
UniProt AC | Q6P9H5 | |
Protein Name | GTPase IMAP family member 6 | |
Gene Name | GIMAP6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | ||
Protein Sequence | MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MEEEEYEQIPQEN --CCHHHHHCCCCCC | 19.20 | 27642862 | |
19 | Phosphorylation | ENPPEELSQDPVLEL CCCCHHHCCCCCHHH | 35.50 | 26552605 | |
27 | Phosphorylation | QDPVLELSGGLREKE CCCCHHHCCCCHHHH | 22.80 | 26552605 | |
37 | Phosphorylation | LREKEQKTPRRLRLI CHHHHCCCCCCEEEE | 23.01 | - | |
53 | Ubiquitination | MGKTGSGKSATGNSI EECCCCCCCCCCCCC | 38.32 | - | |
59 | Phosphorylation | GKSATGNSILGRDVF CCCCCCCCCCCHHHH | 22.12 | 23401153 | |
69 | Ubiquitination | GRDVFESKLSTRPVT CHHHHCCCCCCCCCC | 38.98 | - | |
79 | Phosphorylation | TRPVTKTSQRRSREW CCCCCCCCCHHCHHH | 24.20 | - | |
83 | Phosphorylation | TKTSQRRSREWAGKE CCCCCHHCHHHCCCE | 36.42 | 28634120 | |
172 | Phosphorylation | KEDLAGGSLEDYVRE HHHHCCCCHHHHHHH | 27.89 | 24719451 | |
176 | Phosphorylation | AGGSLEDYVRETNNQ CCCCHHHHHHHHCCH | 7.64 | 24719451 | |
191 | Phosphorylation | ALAWLDVTLARRHCG HHHHHHHHHHHHHCC | 17.86 | 24719451 | |
230 | Phosphorylation | MWENEGDYYSNKAYQ HHCCCCCCHHCHHHH | 21.46 | 29978859 | |
231 | Phosphorylation | WENEGDYYSNKAYQY HCCCCCCHHCHHHHH | 15.54 | 29978859 | |
232 | Phosphorylation | ENEGDYYSNKAYQYT CCCCCCHHCHHHHHH | 26.14 | 29978859 | |
234 | Ubiquitination | EGDYYSNKAYQYTQQ CCCCHHCHHHHHHHH | 42.40 | - | |
246 | Ubiquitination | TQQNFRLKELQERQV HHHCCHHHHHHHHHH | 52.72 | - | |
254 | Phosphorylation | ELQERQVSQGQGSED HHHHHHHHCCCCCCC | 21.91 | - | |
259 | Phosphorylation | QVSQGQGSEDVPGEE HHHCCCCCCCCCCCH | 23.80 | - | |
277 | Ubiquitination | EGLSQIQKESEEAHR HHHHHHHHHHHHHHH | 65.91 | - | |
289 | Ubiquitination | AHRCLLGKADL---- HHHHHHCCCCC---- | 38.40 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GIMA6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GIMA6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GIMA6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...