UniProt ID | GFRA2_HUMAN | |
---|---|---|
UniProt AC | O00451 | |
Protein Name | GDNF family receptor alpha-2 | |
Gene Name | GFRA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 464 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor.; Isoform 2: participates in NRTN-induced 'Ser-727' phosphorylation of STAT3.. | |
Protein Sequence | MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | N-linked_Glycosylation | ELCAAESNCSSRYRT HHHHHHCCHHHHHHH | 22.61 | UniProtKB CARBOHYD | |
71 | Phosphorylation | LAGRDRNTMLANKEC HHCCCHHHHHCCHHH | 17.92 | 30242111 | |
179 | Phosphorylation | DNCKKLRSSYISICN HHHHHHHHHHHHHHC | 37.62 | - | |
357 | N-linked_Glycosylation | NAIQAFGNGTDVNVS HHHHHHCCCCCCCCC | 43.68 | UniProtKB CARBOHYD | |
369 | Phosphorylation | NVSPKGPSFQATQAP CCCCCCCCCCCCCCC | 38.36 | 22985185 | |
396 | O-linked_Glycosylation | SDSTSLGTSVITTCT CCCCCCCCHHHHCCH | 25.72 | OGP | |
401 | O-linked_Glycosylation | LGTSVITTCTSVQEQ CCCHHHHCCHHHHHH | 11.58 | OGP | |
413 | N-linked_Glycosylation | QEQGLKANNSKELSM HHHCCCCCCCHHHHH | 52.28 | UniProtKB CARBOHYD | |
441 | Phosphorylation | NKVIKPNSGPSRARP CCCCCCCCCCCCCCH | 61.68 | - | |
444 | Phosphorylation | IKPNSGPSRARPSAA CCCCCCCCCCCHHHH | 41.94 | - | |
444 | GPI-anchor | IKPNSGPSRARPSAA CCCCCCCCCCCHHHH | 41.94 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GFRA2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GFRA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GFRA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NRTN_HUMAN | NRTN | physical | 9407096 | |
GDNF_HUMAN | GDNF | physical | 9407096 | |
NRTN_HUMAN | NRTN | physical | 10829012 | |
GDNF_HUMAN | GDNF | physical | 10829012 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...