| UniProt ID | GFRA2_HUMAN | |
|---|---|---|
| UniProt AC | O00451 | |
| Protein Name | GDNF family receptor alpha-2 | |
| Gene Name | GFRA2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 464 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
| Protein Description | Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor.; Isoform 2: participates in NRTN-induced 'Ser-727' phosphorylation of STAT3.. | |
| Protein Sequence | MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | N-linked_Glycosylation | ELCAAESNCSSRYRT HHHHHHCCHHHHHHH | 22.61 | UniProtKB CARBOHYD | |
| 71 | Phosphorylation | LAGRDRNTMLANKEC HHCCCHHHHHCCHHH | 17.92 | 30242111 | |
| 179 | Phosphorylation | DNCKKLRSSYISICN HHHHHHHHHHHHHHC | 37.62 | - | |
| 357 | N-linked_Glycosylation | NAIQAFGNGTDVNVS HHHHHHCCCCCCCCC | 43.68 | UniProtKB CARBOHYD | |
| 369 | Phosphorylation | NVSPKGPSFQATQAP CCCCCCCCCCCCCCC | 38.36 | 22985185 | |
| 396 | O-linked_Glycosylation | SDSTSLGTSVITTCT CCCCCCCCHHHHCCH | 25.72 | OGP | |
| 401 | O-linked_Glycosylation | LGTSVITTCTSVQEQ CCCHHHHCCHHHHHH | 11.58 | OGP | |
| 413 | N-linked_Glycosylation | QEQGLKANNSKELSM HHHCCCCCCCHHHHH | 52.28 | UniProtKB CARBOHYD | |
| 441 | Phosphorylation | NKVIKPNSGPSRARP CCCCCCCCCCCCCCH | 61.68 | - | |
| 444 | Phosphorylation | IKPNSGPSRARPSAA CCCCCCCCCCCHHHH | 41.94 | - | |
| 444 | GPI-anchor | IKPNSGPSRARPSAA CCCCCCCCCCCHHHH | 41.94 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GFRA2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GFRA2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GFRA2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NRTN_HUMAN | NRTN | physical | 9407096 | |
| GDNF_HUMAN | GDNF | physical | 9407096 | |
| NRTN_HUMAN | NRTN | physical | 10829012 | |
| GDNF_HUMAN | GDNF | physical | 10829012 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...